KEGG   Azoarcus sp. DN11: CDA09_03375Help
Entry
CDA09_03375       CDS       T05691                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00564  Glycerophospholipid metabolism
azd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CDA09_03375
Enzymes [BR:azd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CDA09_03375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like GIDA FAD_binding_3 Pyr_redox_2 Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AYH42435
LinkDB All DBs
Position
759931..761508
Genome map
AA seq 525 aa AA seqDB search
MSVAGGRGPEVVLDRAALLARLRETESWDMLVIGGGATGLGCAVDASARGHRTLLLEAHD
FAKGTSSRATKLIHGGVRYLAQGKLPLVHEALAERSRLLANAPHLVHRLRFVVPAYRWLD
IPKFGAGLAVYDLLSGVQGIGRSRVLDPANTLVALPTLNPAGLRGGIAYWDAQFDDARLA
VALMRTHFDHGGLALNYLPVDGLIVEDGHVRGVLAHDVETGESFRLRARVVINATGVWAD
AIRRAELPDARPLLKPSQGVHIVVDAGFLPGRDALLVPETADGRVLFVIPWQGRVLIGTT
DSPRQDLPLEPAPLAGEIDFILAAVAPYLVRPPARADIRSVFVGLRPLIGAGDSAATRSL
SREHCIEVSPGGLVTITGGKWTTYRRMAEETLDTAQSVAGLPRHACVTAGLRLHGGEAGV
SSDPYGAARAAVEALPGAGRAVHAGLDLTEAEVRYAARCELARGVEDVLARRHRALFLDA
AAAEAAAPRVAAVLAEELGRDAAWCDAEVERFRTLARHYARPREQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggctggcggtcggggtcctgaggtcgtgctggaccgggcggcgctgctcgcg
cgcctgagggagaccgaatcctgggacatgttggtgatcggcggtggggcgacgggactg
ggctgtgccgtcgatgcgagcgcgcgcgggcaccgcacgctgctgctcgaagcgcatgat
ttcgcgaaaggcaccagctcgcgcgcgaccaagctgatccacggcggcgtgcgctacctg
gcgcagggcaagctgccgctggtgcatgaggcgctcgccgagcggtcgcgcctgctagcg
aatgcgccgcatctcgtgcacaggctgcgtttcgtcgtgcccgcctatcgctggctggac
atccccaagttcggcgccgggcttgccgtctatgacctgctgtcgggcgtgcaaggcatc
ggtcgcagccgcgtcctcgacccggcgaacacgctcgtcgccttgccgacgctcaatccc
gccggcctgcgcggcggcatcgcgtactgggacgcgcagttcgacgacgcccggctcgcc
gtcgccctgatgcgcacgcatttcgaccacggcggactggcgctgaactacctgccggtc
gatggactgatcgtggaggacgggcacgtgcgcggtgtgctcgcccatgatgtggaaacc
ggggagtccttccgtcttcgcgcgcgcgtcgtcatcaatgcgaccggcgtgtgggcggat
gcgatccgccgcgcggagctgccggacgctcgccccctgctcaagcccagccagggcgtg
cacatcgtcgtggatgcgggcttcctgcccgggcgcgacgccctgctggtgcccgaaacc
gccgacggccgcgtgctgttcgtgattccctggcagggccgcgtgctgatcggcaccacc
gattcgccacggcaggatctcccgctcgaaccggcgccgctcgccggggagatcgacttc
attctggccgcggtcgcaccgtatctcgtgcgcccgcccgcgcgcgcggacatccgcagc
gtcttcgtcggtctgcgtccgttgatcggcgcgggcgacagtgccgctacgcgcagcctg
tcgcgcgagcactgcatcgaggtgtcgccgggcggcctcgtcacgatcacgggcggaaaa
tggaccacctaccggcgcatggccgaggagaccctcgatacggcgcaatcggtggcggga
ctgccgcggcacgcctgcgtcacggcagggctgcgcctgcacggcggggaggcgggggtg
tcgtccgatccctacggcgccgcacgcgctgccgtggaggcgttgccgggggccggacgc
gcggtgcacgccggcctcgacctgaccgaggccgaagtccgttacgccgcacgctgcgag
ctcgcgcgcggcgtcgaagacgtgctggcgcggcgccaccgtgcgctcttcctcgacgcg
gcggctgccgaagcggcggcgccgcgggtggccgcggtgctggccgaggagttggggcgg
gacgcggcctggtgcgatgccgaggtggagcgcttccgcacgctcgcccgacactatgcg
cggccccgcgaacaatga

DBGET integrated database retrieval system