KEGG   Azoarcus sp. DN11: CDA09_03730
Entry
CDA09_03730       CDS       T05691                                 

Definition
(GenBank) DNA polymerase III subunit delta
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03430  Mismatch repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_03730
   03430 Mismatch repair
    CDA09_03730
   03440 Homologous recombination
    CDA09_03730
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_03730
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_03730
Enzymes [BR:azd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CDA09_03730
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CDA09_03730
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CDA09_03730
SSDB
Motif
Pfam: DNA_pol3_delta DNA_pol3_delt_C
Other DBs
NCBI-ProteinID: AYH42504
UniProt: A0A3Q8HTY6
LinkDB
Position
complement(837080..838087)
AA seq 335 aa
MILRPDQLPALLDKPLAPLYLLHGNEPLLVLEAADLIRAAARRQGFEERETLVVGQGFRW
DSLNAAAGNFSLFGGAKLIDLRIPNGKPGREGGEALQRHARRPGDGIVTLITLPELDWAA
RKATWFTTLCDAGIAAELNAPERERLPDWIAARLARQHQSAPAEALTFIADHVEGNLLAA
HQEIFKLGLLHGEARLTLEDVQDAVLNVARYDIDKLRQAILEGDPVRCTRLLEGLQGEGA
APPLVLWALANEIRTLANLAAGVAAGQQLAPLLKAERVFDERRRQAIQRALPRLKAATLR
AALLHAARIDRIIKGLVTGDVWDEFLQLTLRFVRH
NT seq 1008 nt   +upstreamnt  +downstreamnt
gtgatcctgcgccccgaccagctccccgcccttctcgacaagccgctcgccccgctctat
ctcctgcacggcaacgaaccgctgctcgtgctcgaagcggccgacctgatccgcgccgcg
gcgcgccgccagggcttcgaggaacgcgagacgctggtcgtcggccagggattccgctgg
gacagtctcaacgcggccgccggcaatttctcgctcttcggcggcgccaaactcatcgac
ctgcgcattccgaacggcaagcccgggcgggaaggcggcgaggcgctgcagcggcacgcg
cgccgccccggcgacggcatcgtcacgctgatcaccctcccggaactcgactgggcggcg
cgcaaggccacctggttcaccaccctgtgcgatgccggcatcgccgccgaactgaacgcg
cccgaacgcgaacggctcccggactggatcgccgcacgactcgcgcggcagcaccagtcc
gcccccgccgaagccctcacgttcatcgcggaccacgtcgaaggcaaccttctcgcggcc
caccaggaaatcttcaagctcggcctcctgcacggggaagcacgcctcaccctggaagac
gtgcaggacgcggtcctcaacgttgcgcgctacgacatcgataagctgcgccaggcgatc
ctcgaaggcgaccccgtgcgctgcacgcgcctgctcgaaggcctgcagggcgaaggcgcc
gcgccgccgctcgtgctgtgggcactcgcgaacgagattcgcacgcttgcgaacctcgcc
gctggcgtggccgccggccagcaactcgcgcccctgctcaaagccgagcgcgttttcgac
gaacgacgccgccaggccatccagcgcgcgctgccgcgcctgaaggccgcgaccttgcgc
gccgccctgctgcatgcggcgcgcatcgaccggatcatcaagggactcgttaccggcgac
gtgtgggacgagttcctgcagctcacgctccggttcgtccgccactag

DBGET integrated database retrieval system