KEGG   Azoarcus sp. DN11: CDA09_08015Help
Entry
CDA09_08015       CDS       T05691                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00030  Pentose phosphate pathway
azd01100  Metabolic pathways
azd01120  Microbial metabolism in diverse environments
azd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CDA09_08015
Enzymes [BR:azd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CDA09_08015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AYH43326
LinkDB All DBs
Position
1754125..1755972
Genome map
AA seq 615 aa AA seqDB search
MAWNRKLLRVNLTQGTCKEEPLNMEWANEYLGSRGLAAKYLVSEIDPRVDPLSPDNKLIM
ATGPLTGTMASTGGRYTVSCKGPLTGAIACSNSGGFFGAEMKFAGWDMIIFEGKSPKPVY
LFIENDKAELRDAAHLWGTSCWHTEEQIKADHQDPLIRVSSIGKAGENQVLFAVVINDLH
RAAGRSGVGAVMGSKNLKAVAIRGTKGVSGIKDFPAFLKATQDAKKVLADNAVTGEGLPK
YGTQVLMNVINEIGALPTRNHRDVQFEDAAKISAEAMHEKRPSDGKTHLITNAACFGCTI
ACGRISQIDKDHFTVKNSPQYWGASGGLEYEAAWALGAANGVGDLEALQYANLLCNEQGM
DPITFGATVAAAMELYEMGILTKEQIGIESPFGSAAALAKFAEMAANGEGFGKEIGMGSA
RLCEKYGHPELSMSVKKQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPHVTDGKAELVKAFQDATAVFDAAGICVFTSFAWTLADVQPQLAAACGPEWTMEKLNE
VGERIWNLERQFNNAAGFTAKDDNLPPRLTTEPAKTGPAKGLVNQLDKMLPEYYKVRGWT
PDGVPTSETLARLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcatggaatcgcaagctcctgcgcgtgaacctcacccagggtacgtgcaaggaagag
cccctcaacatggagtgggccaacgagtacctcggctcgcgcggcctcgcggcgaagtat
ctcgtctcggagatcgaccccagggtcgacccgctgtcgcccgacaacaagctgatcatg
gcgaccggtccgcttaccggcacgatggcctctaccggcgggcgctacaccgtcagctgc
aagggaccgctcaccggcgcgatcgcgtgctcgaactcgggcggcttcttcggcgccgag
atgaagttcgccggctgggacatgatcatcttcgagggcaagtcgccgaagcccgtctac
ctcttcatcgagaacgacaaggccgagttgcgcgacgccgcccacctgtggggcaccagc
tgttggcacaccgaagagcagatcaaggccgaccaccaggatccgctgatccgcgtctcg
tcgatcggcaaggcgggcgagaaccaggtgctgttcgcggtcgtcatcaatgacctgcac
cgcgccgcggggcgctcgggcgtcggcgccgtgatgggctcgaagaacctcaaggcggtc
gccatccgcggcaccaagggcgtgtcgggcatcaaggacttcccggccttcctcaaggcg
acccaggacgcgaagaaggtgctcgccgacaacgccgttaccggcgagggcctgcccaag
tacgggacccaggtgctgatgaacgtcatcaacgagatcggcgcactgcccacgcgcaac
caccgcgacgtgcagttcgaggacgccgccaagatctccgccgaggcgatgcacgagaag
cgcccctccgacggcaagacgcacctcatcaccaatgccgcctgcttcggctgcacgatc
gcctgcggacgcatctcgcagatcgacaaggaccacttcaccgtcaagaacagcccgcag
tattggggcgcctcgggcggtctggagtacgaagccgcgtgggcgctgggggccgcgaac
ggcgtcggcgacctcgaagccctgcagtacgcgaacctgctgtgcaacgagcagggcatg
gacccgatcaccttcggtgccaccgtcgccgcggcgatggaactctacgagatgggcatc
ctgaccaaggagcagatcgggatcgagagtccgttcggatcggccgcggcgctcgcgaag
ttcgcagaaatggccgcgaacggtgagggcttcggcaaggagatcggcatgggttcggca
cgcctgtgcgagaagtacggccacccggaactgtcgatgagcgtcaagaagcaggaattc
ccggcctacgactcgcgcggcatccagggcatgggcctcgcctatgcgacctcgaaccgc
ggtgcctgccacctgcgcggctacaccgtcgcgtccgaagtgctgggcatcccggtcaag
accgacccgcacgtcaccgacggcaaggccgagctcgtgaaggccttccaggacgcgacc
gcggtgttcgacgcggccggcatctgcgtgttcacgtccttcgcctggacgctcgcggac
gtgcagccccagctcgcggcagcctgcgggcccgaatggacgatggagaagctcaacgaa
gtgggcgaacgcatctggaacctcgagcgccagttcaacaacgcggccggtttcaccgcc
aaggacgacaacctgccgccgcgcctgacgaccgaaccagccaagaccggcccggccaag
ggcctggtgaaccagctcgacaagatgctgcccgagtactacaaggtccgtggctggacg
cccgacggtgtgccgacctcggagaccctggcgcgactgggactctga

DBGET integrated database retrieval system