KEGG   Azoarcus sp. DN11: CDA09_09115Help
Entry
CDA09_09115       CDS       T05691                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
azd  Azoarcus sp. DN11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AYH43540
LinkDB All DBs
Position
1988019..1989497
Genome map
AA seq 492 aa AA seqDB search
MQAAQYIQEALYIGGQWVKPAASAVLEVRSPATEEIIGRAPSCSPADIDRAVQAARAAFE
GPASAWARTTVTERIAYLRAFGAALKKRRQQLAEVTSDEGGQPLAKNCVYQVDKALSIID
YYAQLGETYPFEERRQGYDNPFIVRKEPIGVVGLIMPWNAPLAISFFPLAPALLAGCTVV
LKPSPETPLHAYVLAQACEEAGLPPGVVNIVPADREASEALVTHPGVDKIAFTGSTATGR
RIASLCGERLKRYSLELGGKSAAIILEDVDLHKAMPMIVRTATMNSCEACVGQTRTLVPR
SRYAEIVEAFVSGVARLKMGDPRHPDTDMGPLIAERQRTRVESYIKAGREEGARLMLGGG
RPAHLTRGWYVEPTVFADVGNHMRIAREEIFGPVLSLIPYNDETDAIAIANDSTYGLSGT
VWTSDPKRGVEVARRVRTGNYGVNLFNLDIAAPFGGFKESGIGRQLGPEGLDGFFETKAI
QLSPADVAAGKL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctgcgcagtacatccaggaagctctctatatcggcggacaatgggtaaaaccc
gcggcgtccgcggtgctcgaggtccgctcgccggccacggaggagatcatcgggcgcgcg
ccgtcgtgctcgcctgccgatatcgaccgggccgtccaggcggcccgtgcggccttcgag
ggtcccgcttcggcgtgggcgcgcaccacggtgacggaacgcatcgcctacctgcgcgcg
ttcggcgccgccttgaagaaacggcgccagcaactggccgaagtgacgagcgacgaaggc
ggtcagccgctggcgaagaattgcgtctatcaggtcgacaaggccctgtcgatcatcgat
tactacgcacaactgggcgagacgtatccgttcgaggagcggcggcaggggtacgacaac
cccttcatcgtgcgcaaggagcccatcggcgtcgttggcctgatcatgccgtggaacgcg
ccgctggcgatctcgttcttcccgctggcaccggcgctgctggccggatgtacggtcgtg
ctgaagccgtcgcccgaaaccccgctgcacgcctacgtactggcgcaagcctgcgaggag
gcagggctgccgccgggggttgtgaacatcgttccggccgaccgtgaggcgagcgaggcg
ctcgtcacgcacccgggcgtcgacaagattgcctttaccggcagcacggccaccggacga
cgcatcgcatcgctgtgcggcgagcggctcaagcgctacagcctcgaactgggcggcaag
tccgcggcgatcatcctcgaggatgtggacctgcacaaggcgatgccgatgatcgtccgc
acggccacgatgaacagttgcgaggcctgcgtggggcagacccgcacgctggtaccgcgc
agccgttacgcggagatcgtcgaggccttcgtgtccggcgtcgccaggctcaagatgggc
gacccccgccatcccgacaccgacatggggccgctgatcgcggaacgccagcggacccgc
gtcgaaagctacatcaaggccggccgcgaggaaggtgcgcggctcatgctcggcggcggc
cgtccggcccacctgacgcgcggctggtacgtcgagccgacggtgttcgccgacgtcggg
aaccacatgcgcatcgcccgcgaggagatcttcgggccggtcctgagtttgattccctac
aacgacgagacggacgcgatcgcgatcgccaatgacagcacctacggcctttcggggacg
gtgtggacgagcgatccgaaacgtggcgtcgaggtggcgcgccgcgtgcgtaccggcaac
tacggcgtcaatctgttcaatctcgatatcgctgcgcctttcggcgggttcaaggagtcg
ggcatcggccggcaactcggcccggaaggcctcgacggattcttcgaaaccaaggcgatt
cagctgtcgccggccgacgtcgccgccggcaagctgtga

DBGET integrated database retrieval system