KEGG   Azoarcus sp. DN11: CDA09_10870Help
Entry
CDA09_10870       CDS       T05691                                 

Gene name
cobT
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00860  Porphyrin and chlorophyll metabolism
azd01100  Metabolic pathways
Module
azd_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDA09_10870 (cobT)
Enzymes [BR:azd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     CDA09_10870 (cobT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT Nitro_FeMo-Co DUF1127
Motif
Other DBs
NCBI-ProteinID: AYH43886
UniProt: A0A3Q8I148
LinkDB All DBs
Position
complement(2375134..2376174)
Genome map
AA seq 346 aa AA seqDB search
MHSEFSVPAPDRAFAVALQHKIDRKTKPLGALGDLEGLGLKIGLVQQSLTPALRNPHVIV
FAGDHGAAKAGVSAYPQDVTWQMVENFLAGGAGINVFARQNGLGLTVVDAGVAHDFGPRP
GLIDAKVGPGTRNFLEEPAMTRAECATAMERGAGIVRTLAVDGCNIVGFGEMGIGNTAAA
SLITHCLTGTPLADCIGRGTGLDDAGVARKRQLLEKALARTGKVDDPLSVLAEFGGFEIA
MMAGAMVAAARAGMVLLIDGFIVGSAALTAARLAPAITDYCVFCHRSAEPGHLAQLSALD
ARPLIDLGLRLGEGTGAALAYPLVQAAVNFVNEMASFESAGVSDKE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcattctgaattttccgtgccagccccggatcgggcgtttgccgttgccctgcagcac
aagatcgatcgcaagaccaaaccgctcggcgcgctcggtgatctggaaggcctcggactc
aagatcgggctggtgcagcagagcctcacacccgcgctgaggaaccctcacgtgatcgtc
ttcgcgggcgaccatggagcggccaaggcgggtgtgtcggcctacccgcaggacgtgacc
tggcagatggtcgaaaatttcctcgccggcggcgcaggcatcaatgtcttcgcccgtcag
aacggccttgggctgaccgtggtcgatgccggcgtagcacatgatttcggtccgcgcccg
gggctgatcgatgccaaggtggggccgggaacgaggaattttctcgaagagccggcgatg
acccgggccgagtgcgccacagccatggagcgcggcgccggcatcgtccgcaccctagcc
gtcgacggttgcaacatcgtcggcttcggcgaaatgggtatcggcaacaccgccgccgcc
tcgctcattacccactgcctgaccggaacgccgctggccgattgcatcgggcgcggcacc
ggcctcgacgacgccggcgttgcgcgtaagcgccaattgctggaaaaggccctcgcccgc
accggcaaggtggacgatcccctgtcggtgctcgccgaattcggcggcttcgaaatcgcg
atgatggcgggcgcgatggtggcggcagcccgggccgggatggtgctgctgatcgacggt
ttcattgtcggatcggctgcactgacggccgcccgcctcgcgccggccatcaccgactac
tgcgtgttctgccaccgttcggccgagcccggccaccttgcgcagttgagcgcgctcgac
gcccgcccgctcatcgacctcggcttgcgcctgggcgaaggcaccggcgcggcgctggcc
tatcccctggtgcaggcggccgtcaatttcgtcaacgagatggcgagcttcgagtcggct
ggcgtttccgacaaggagtga

DBGET integrated database retrieval system