KEGG   Azoarcus sp. DN11: CDA09_11570Help
Entry
CDA09_11570       CDS       T05691                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00630  Glyoxylate and dicarboxylate metabolism
azd00710  Carbon fixation in photosynthetic organisms
azd01100  Metabolic pathways
azd01120  Microbial metabolism in diverse environments
azd01200  Carbon metabolism
Module
azd_M00165  Reductive pentose phosphate cycle (Calvin cycle)
azd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CDA09_11570
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CDA09_11570
Enzymes [BR:azd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CDA09_11570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AYH44014
LinkDB All DBs
Position
2530548..2530973
Genome map
AA seq 141 aa AA seqDB search
MRITQGAFSFLPDLTDAQISAQVEYCLVQGWAVSIEYTDDPHPRNTYWSMWGHPMFDLVD
PAGVMSELAECRATWPDRYIRINAFDSMHGWETMRMSFLVNRPAHEPGFRLVRQEGEGRV
VRYTLESYAVVRAPEGERYTA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcacccaaggcgccttttccttcctgcccgacctcaccgacgcgcagatctcc
gcgcaggtcgagtactgcctggtgcagggttgggcggtcagcatcgaatacaccgacgac
ccgcacccgcgcaacacctactggtcgatgtggggccacccgatgttcgacctcgtcgat
cccgccggcgtcatgagcgagctcgccgaatgccgcgcgacctggcccgaccgctacatc
cgcatcaacgcgttcgactccatgcatggctgggaaacgatgcgcatgtcgttcctcgtc
aatcggccggcgcacgagcccggcttccgcctcgtgcgccaggaaggcgaagggcgcgtc
gtgcgctacacgctcgaaagctacgccgtcgtgcgcgcgcccgaaggagaacgctacacc
gcctga

DBGET integrated database retrieval system