KEGG   Azoarcus sp. DN11: CDA09_11750
Entry
CDA09_11750       CDS       T05691                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00362  Benzoate degradation
azd01100  Metabolic pathways
azd01120  Microbial metabolism in diverse environments
azd01220  Degradation of aromatic compounds
Module
azd_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDA09_11750
Enzymes [BR:azd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     CDA09_11750
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYH44050
UniProt: A0A3S7UG85
LinkDB
Position
complement(2569315..2570088)
AA seq 257 aa
MTSVILTETRGKVGLIRINRPEVFNALNDDVMTAIGEALDGFDADPSIACVVVTGSEKAF
AAGADIAAMRAMDYMDAYKGDFITRNWERLKTFRKPTIAAVSGVALGGGCELAMMCDIVF
AADNARFGQPEIRIGTIPGAGGTQRLPRAVGKTKAMDLCLTGRMMDAQEAERSGLVARIF
PPESVLDEALAAAAKIAEFSLPVLMMMKETVNRAFEGPLNEGLLFERRTLHATFGLADQK
EGMAAFVEKRPPRFTHR
NT seq 774 nt   +upstreamnt  +downstreamnt
atgacttcggtaatcctcactgaaacgcgcggcaaagtcggcctcatccgcatcaaccgc
ccggaagtcttcaatgcgctcaacgacgacgtgatgaccgcgatcggcgaggcgctcgac
ggcttcgatgcggaccccagcatcgcctgcgtcgtggtgaccggctccgaaaaagccttc
gctgccggcgcagatatcgcggcgatgcgggcgatggactacatggacgcctacaagggc
gacttcatcacgcgcaactgggaacgcctcaagaccttccgcaagccgaccatcgccgcg
gtatcgggcgtcgcgctgggcggtggatgcgaactggcgatgatgtgcgacatcgtcttc
gctgccgacaatgcccgcttcggccagccggagatcaggatcggcaccattcccggcgcc
ggcggcacgcagcgcctgccgcgtgcggtgggcaagaccaaggcgatggacctgtgcctc
accgggcgcatgatggacgcgcaggaagcggagcgcagcggcctggtcgcgcgcatcttc
ccgcccgaaagcgtgctcgacgaagcgctcgccgcggccgcgaagatcgccgagttctcg
ctgccggtgttgatgatgatgaaggaaacggtgaaccgcgccttcgagggaccgctcaac
gaaggcctgctgttcgagcggcgcacgctgcacgcgaccttcggtctggcggatcagaag
gaaggcatggccgccttcgtcgagaagcgtccgccgcgcttcactcaccgctga

DBGET integrated database retrieval system