KEGG   Azoarcus sp. DN11: CDA09_11920
Entry
CDA09_11920       CDS       T05691                                 

Definition
(GenBank) ribonuclease HI
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_11920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_11920
Enzymes [BR:azd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     CDA09_11920
DNA replication proteins [BR:azd03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    CDA09_11920
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     CDA09_11920
   Elongation factors (archaeal)
     CDA09_11920
SSDB
Motif
Pfam: RNase_H RVT_3
Other DBs
NCBI-ProteinID: AYH44083
UniProt: A0A3Q8HVU8
LinkDB
Position
2604968..2605429
AA seq 153 aa
MEEVEIFTDGACSGNPGPGGWGAILRSGLHEKEIWGGEPQTTNNRMELLAVIRALETLKR
PVAARVHTDSQYVQKGISEWIHGWKKRGWKTASREPVKNEDLWRALDEAASRHKVAWIWV
RGHAGHAENERADELARRGVAAVRAQGRAVAEI
NT seq 462 nt   +upstreamnt  +downstreamnt
atggaagaagtcgaaatattcaccgacggggcctgcagcggcaacccgggccccggcggc
tggggcgcgatcctgcgcagcggcctgcacgagaaggaaatctggggcggcgagccccag
accaccaacaaccgcatggaactgctcgcagtgatccgcgcgctggagacgctcaagcgt
cccgtggcggcgcgcgtgcacaccgacagccagtacgtgcaaaagggtatctcggaatgg
atccacggctggaagaagcgcggctggaagaccgcctcgcgcgagccggtgaagaacgag
gatctgtggcgggcgcttgatgaggcggcgagccggcacaaggtcgcgtggatctgggtg
cgcggtcacgcgggccatgccgaaaacgagcgcgcggacgagcttgcgcgacggggcgtc
gcggccgtgcgcgcgcagggcagggccgttgccgagatctga

DBGET integrated database retrieval system