KEGG   Azoarcus sp. DN11: CDA09_13185Help
Entry
CDA09_13185       CDS       T05691                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00020  Citrate cycle (TCA cycle)
azd00310  Lysine degradation
azd00380  Tryptophan metabolism
azd01100  Metabolic pathways
azd01110  Biosynthesis of secondary metabolites
azd01120  Microbial metabolism in diverse environments
azd01130  Biosynthesis of antibiotics
azd01200  Carbon metabolism
Module
azd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDA09_13185
  09105 Amino acid metabolism
   00310 Lysine degradation
    CDA09_13185
   00380 Tryptophan metabolism
    CDA09_13185
Enzymes [BR:azd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CDA09_13185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AYH44329
UniProt: A0A3Q8HTE7
LinkDB All DBs
Position
complement(2871641..2872825)
Genome map
AA seq 394 aa AA seqDB search
MLIEVKVPQLSESVSEATLVSWHKKEGDAVARDENLIDIETDKVVLEIPAPADGVLVKII
KANGDNVNSGELIAQIDTEAKAAAGAAAAPAPAAAPAAAAPAAAAGTASPAARKILEEKG
IIAGDVAGTGRGGRVTKEDAVAAQVRPAAVAAAPAPLALTGERPEERVPMTRLRARIAER
LIQSKNENAILTTFNEVNMAPVMALRKQYGDKFEKAHGVRLGFMGFFVKAAVAALKKFPI
LNASVDGSDIVYHGYVDIGIAVGSPRGLVVPILRDADQMSIADIEKKIAEYGQKAKDGKL
TLEELSGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKDRPVVENGQIVIRPINYLA
MSYDHRIIDGREAVLGLVTMKEALEDPARLILDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgaagtaaaagtgccgcaactgtcggaatccgtctccgaagccacgctggtg
tcgtggcacaagaaggaaggggacgccgtcgcgcgcgacgagaacctgatcgacatcgaa
accgacaaggtcgtgctcgagatcccggcccccgccgacggcgtcctcgtgaagatcatc
aaggcaaacggcgacaacgtgaactcgggcgagctgatcgctcagatcgacaccgaagcg
aaggctgcggcaggtgctgcagcggcgcccgctccggcagcggcacccgccgctgcagcg
cccgcggcggcagccggtacggccagccccgcagcgcgcaagatcctcgaagagaagggc
attattgctggggatgtggcgggcaccggccgtggtggccgcgtgaccaaggaagacgcg
gttgctgcccaggtgcgcccggcggcagtcgctgctgcgcccgcgccgcttgccttgacg
ggcgagcgtccggaagagcgcgtcccgatgacccgtctgcgcgcccgcatcgccgagcgc
ctgatccagtcgaagaacgagaacgccatcctgaccacgttcaacgaagtgaacatggcg
ccggtgatggccctgcgcaagcagtacggcgacaagttcgagaaggcacatggcgtgcgc
ctgggcttcatgggctttttcgtcaaggctgccgttgccgcgctgaagaagttcccgatc
ctgaacgcgtcggtcgatggcagcgacatcgtctaccacggctacgtggatatcggtatc
gccgtcggttcgccgcgcggcctggtcgtgccgatcctgcgcgacgcggatcagatgtcg
atcgccgacatcgagaagaagatcgccgagtacggtcagaaggccaaggacggcaaactg
acgctggaggagctttcgggtggcaccttctcgatctccaacggtggcgtgttcggttcc
atgctgtcgacgccgatcatcaacccgccgcagtccgccatccttggcatccacgcgacg
aaggaccgtccggtggtcgagaacgggcagatcgtgatccgtccgatcaactacctggcc
atgtcgtacgaccatcgcatcatcgacggccgcgaagccgtgctcggcctcgtgacgatg
aaggaagcgctggaagatccggcccgcctgatcctcgacgtgtaa

DBGET integrated database retrieval system