KEGG   Azoarcus sp. DN11: CDA09_13945
Entry
CDA09_13945       CDS       T05691                                 

Definition
(GenBank) hypothetical protein
  KO
K03111  single-strand DNA-binding protein
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03430  Mismatch repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_13945
   03430 Mismatch repair
    CDA09_13945
   03440 Homologous recombination
    CDA09_13945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_13945
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_13945
   03029 Mitochondrial biogenesis [BR:azd03029]
    CDA09_13945
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CDA09_13945
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     CDA09_13945
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CDA09_13945
Mitochondrial biogenesis [BR:azd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    CDA09_13945
SSDB
Motif
Pfam: SSB tRNA_anti-codon
Other DBs
NCBI-ProteinID: AYH44475
UniProt: A0A3Q8HY34
LinkDB
Position
complement(3037820..3038266)
AA seq 148 aa
MFYVDAKECNMPNVFRGKGNLGDTPILKHVPINGVDEVVAEMRVFFDDYAYDQTNDEYQQ
VGGFWMSVSLWGQRGEDAARVLRRGARVQVEGVLKQFMYSPEGAPDKVPGFQVTADDVTL
CLGRVERADYKPKRELAGSTSEAAVDAT
NT seq 447 nt   +upstreamnt  +downstreamnt
gtgttctacgtcgacgccaaggagtgcaacatgccgaacgtatttcgcgggaaaggcaat
ctcggcgatacgccgatcctcaagcacgtcccaatcaacggggtcgatgaggtcgtcgcc
gagatgcgcgtgttcttcgacgactacgcctacgaccagaccaacgacgaatatcagcag
gtcggcggattctggatgagtgtgtcgctgtggggccagcgcggcgaggacgccgcgcgc
gtgctgcggcgaggtgcgcgcgtgcaggtcgaaggcgtcctcaagcagttcatgtactcg
ccggagggcgcccccgacaaggtgcccggcttccaggtgaccgctgacgacgtcacgcta
tgcctgggccgggtcgagcgagccgactacaaacccaagcgcgagctcgctggttccacg
agcgaggcggctgtcgacgccacgtaa

KEGG   Azoarcus sp. DN11: CDA09_19370
Entry
CDA09_19370       CDS       T05691                                 

Definition
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03430  Mismatch repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_19370
   03430 Mismatch repair
    CDA09_19370
   03440 Homologous recombination
    CDA09_19370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_19370
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_19370
   03029 Mitochondrial biogenesis [BR:azd03029]
    CDA09_19370
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CDA09_19370
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     CDA09_19370
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CDA09_19370
Mitochondrial biogenesis [BR:azd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    CDA09_19370
SSDB
Motif
Pfam: SSB tRNA_anti-codon
Other DBs
NCBI-ProteinID: AYH45514
UniProt: A0A3Q8HSW0
LinkDB
Position
complement(4180795..4181277)
AA seq 160 aa
MASLNKVILIGNLGRDPETRYAPSGDAICNITVATTETWKDKQSGERKEATEWHRVVFFG
RLAEIAAQYLRKGSQVYVEGRLQTRKWQDKDGQDRYTTEIRGDEMKMLGSRQGGGGDAPM
GGYEAPSAPARPAPQQAPAQKAPSQSGSGGFGDFDDDIPF
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcttccctgaacaaagtcatcctgatcggcaacctggggcgcgatccggaaacccgc
tacgcgccgagcggtgacgcgatctgcaacatcaccgtggcgaccaccgaaacgtggaag
gacaagcaaagcggtgagcgcaaggaagcgaccgagtggcaccgcgtggtgttcttcggc
cgcctcgcggagatcgccgcgcagtacctgcgcaagggcagccaggtctatgtcgagggg
cgcctgcagacgcgcaaatggcaggacaaggacggccaggaccgctacacgaccgagatc
cgcggtgacgaaatgaagatgctggggtcgcgccagggcgggggtggcgacgcaccgatg
ggcggttacgaggcgccttccgcgcccgcccgcccggcgccgcagcaggcgccggcccag
aaggcgccgagccagtcggggagtggcggattcggggatttcgacgacgatatcccgttc
tga

KEGG   Azoarcus sp. DN11: CDA09_22160
Entry
CDA09_22160       CDS       T05691                                 

Definition
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03430  Mismatch repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_22160
   03430 Mismatch repair
    CDA09_22160
   03440 Homologous recombination
    CDA09_22160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_22160
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_22160
   03029 Mitochondrial biogenesis [BR:azd03029]
    CDA09_22160
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CDA09_22160
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     CDA09_22160
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CDA09_22160
Mitochondrial biogenesis [BR:azd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    CDA09_22160
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-ProteinID: AYH46045
UniProt: A0A3Q8I3K6
LinkDB
Position
complement(4768394..4768777)
AA seq 127 aa
MSTHFVGEGNIGSAPDYREFPNGNDEPRRLLRLNVYFDNPIPKRDGEYEDRGGFWAPVEL
WHRDAEHWQSLYQKGMRVLVEGRTVRDEWEDADENERVTFKIEARRVGILPYRIETVMLG
AKPAGGQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atgagcacgcacttcgtcggcgagggcaacatcggttctgcgccggactaccgcgaattc
cccaacggcaatgacgaaccgcgcaggctgctgcggctgaacgtctatttcgacaatccg
atcccgaagagggatggcgagtacgaggaccgcggcggcttctgggcgccggtggagctg
tggcaccgcgatgccgagcactggcagtcgctgtaccagaaaggcatgcgcgttctggtc
gaaggccgtaccgtgcgcgacgaatgggaggacgccgacgagaacgagcgcgtcaccttc
aagatcgaagcccggcgcgtcggcatcctgccgtatcgcatcgagacggtgatgctcggc
gccaaaccggccgggggccagtag

DBGET integrated database retrieval system