KEGG   Azoarcus sp. DN11: CDA09_14365Help
Entry
CDA09_14365       CDS       T05691                                 

Definition
(GenBank) benzoate transporter
Organism
azd  Azoarcus sp. DN11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Glyco_transf_21 Glyco_hydro_17
Motif
Other DBs
NCBI-ProteinID: AYH44555
UniProt: A0A3Q8HTQ8
LinkDB All DBs
Position
3123325..3125970
Genome map
AA seq 881 aa AA seqDB search
MKNAASLIYRIIVALILAGIVAGAQYLIAERWNRGTEFVGAANSIHGYAYSPFQRDQNPL
QGTYPSEAEIGADLDLLAQSAEHIRTYGSLENPSIVPLAADRDLTVMAGAWIGPDAEKNE
KEVDAVIEAARKYSHVNRVIIGNEALLRGDVTVKELAVYLDKARKALRRLKKPVSTAEPW
HVWLKNPQLADSVDFITVHLLPYHEGVPVENAVDYALMRYDELVKRFPKKKIVIGEIGWP
SRGPMMDSLGGGDTKGVASAENQARFIREFLANPRSASLDYYIMEAIDQPWKIEIEGWAG
AYWGMFNADRHPKFALDGLVVKDVRWHEKARSAALIAFLPMFLLAFFLRDWSVLGRLWLA
GLVQACAATLVVGLNVPADYYLTQRDLIGLTMLIGATLLTIAVLLSHGFEFGEVLFKRRW
KRRFLPLPPHDADKEPFVSIHLACCNEPPEMVIATIDSLAAMKYRNFEVLVLDNNTKDEA
LWKPLEKRCAELGPRFRFYHLDNWPGFKAGALNFGLRQTDPRAEVVGVVDADYVVSPDWL
SCLIPHFDDGDVAVVQAPQAHRDWETQPFRRMCNWEFDGFFRIGMHHRNERNALIQHGTM
TLVRRLALDEVGGWSEWCICEDTELGLRLIEKGYDTRYVDHILGRGLTPADFPAIKSQRF
RWAFGAMQILKHHLPAMIGPSRLNLAQRYHFLTGWFAWLGDALQLVFAFASLAWTVGILF
YPKAFGLPVTSLALPILAFMAFKAGLGPILYRRTMDAPWKDILGASVLSVGLAHAIARGV
FAGLVKRRGEFVRTPKGWKDKGTLAFFSPLREEIGLLVALMLGAAVLLFQRGFEDLEVQL
WVGILGLQCIPYIAAIACQVASYMPEGKAETPLPAGTGLQT
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcggcttcgctgatttaccgaattatcgtagcgctcatacttgccggaatc
gtcgccggcgcgcagtacctgatagcagaacgctggaaccgcggcaccgaattcgtcggc
gccgccaacagcatccacggatacgcctacagccccttccagcgggaccagaatcccctg
caaggcacttacccgagcgaggccgagatcggcgccgatctcgacctgctcgcccagtcc
gccgaacacatccgcacctacggcagcctcgagaacccctccatcgtcccgctcgcggcc
gatcgcgacctcaccgtgatggccggcgcgtggatcgggcccgacgctgagaagaacgag
aaggaagtcgacgcggtcatcgaagccgcccgcaagtattcgcacgtaaaccgcgtgatc
atcggcaacgaggcgctgctgcgcggcgacgttaccgtgaaggagctggccgtctacctc
gacaaggcgcgcaaggccctcaggcgcctgaagaagccggtctcgaccgccgaaccctgg
cacgtctggctgaagaatccccaactcgccgacagcgtcgacttcatcaccgtccatctc
ctgccctaccacgagggcgtgccggtcgaaaacgccgtcgactacgcgctcatgcgttac
gacgaactcgtcaagcgcttcccgaagaagaagatcgtcatcggcgaaatcggctggccc
agccgcggcccgatgatggacagtctgggcggcggcgacaccaagggggttgcctcggcc
gagaaccaggcacgcttcatccgcgagttcctcgccaatccgcgctcggcctcgctcgac
tactacatcatggaagcgatcgaccaaccgtggaagatcgagatcgaaggctgggccggt
gcgtactggggcatgttcaatgccgaccgccatccgaagttcgcccttgacggcctggtc
gtcaaggacgttcgctggcacgaaaaggcgcgctccgccgcgctgatcgccttcctgccg
atgttcctgctcgcgttcttcctgcgcgactggagcgtgctgggccgcctgtggcttgca
gggctcgtgcaggcctgtgccgcgacgctcgtggtcggcctcaacgtcccggccgactac
tatctcacgcagcgcgacctgatcgggctgacgatgctgatcggcgcaaccctgctgacg
atcgcggtgctgctgtcgcacggtttcgaattcggcgaagtgctgttcaagcgccgctgg
aaacgccgcttcctgcccttgccgccgcacgacgccgacaaggaacccttcgtatcgatc
cacctcgcgtgctgcaacgagccgcccgaaatggtcatcgcgaccatcgacagcctcgcc
gcgatgaagtatcggaacttcgaagtcctcgtgctcgacaacaacaccaaggacgaggcg
ctgtggaagccgctggaaaagcgctgcgccgaactgggcccgcgtttccgtttctaccac
ctcgataactggccgggcttcaaggccggcgcgctgaacttcggcctgcgccagaccgac
ccccgtgccgaagtggtcggcgtcgtcgatgccgactacgtcgtgtcgccggactggctg
tcgtgcctgattccgcacttcgacgacggcgacgtcgccgtcgtgcaggcgccgcaggca
caccgcgactgggaaacccaacccttccgccgcatgtgcaactgggaattcgacggcttc
ttccgcatcggcatgcaccaccgcaacgagcgcaacgcgctgatccagcacggcacgatg
acgctggtgcgccgtctcgcgctcgacgaggtcggcggctggtcggaatggtgcatctgc
gaggacaccgagctgggcctgcgccttatcgaaaagggttacgacacccgctacgtcgac
cacatcctcgggcgcggcctgacgcctgccgacttccccgcaatcaagagccagcgcttc
cgctgggccttcggcgcgatgcagatcctcaagcaccacctgcccgcgatgatcggcccg
agccggctcaacctcgcccagcgctaccacttcctcaccggctggttcgcctggctcggc
gatgccctgcagctcgttttcgccttcgcgagcctcgcctggaccgtcggcatcctgttc
tacccgaaggccttcgggctgccggtcacttcgctggcgctgcccatcctcgccttcatg
gccttcaaggcaggcctcggccccatcctctaccgtcgcacgatggatgccccgtggaag
gacattctcggcgcatcggtgctctcggtaggcctcgcccacgcgatcgcacgcggcgtg
tttgccggtctcgtcaagcggcgcggcgaattcgtgcgcaccccgaagggctggaaggac
aagggtaccctcgccttcttctcgccgctgcgcgaggagatcgggctgctcgtcgccctg
atgctcggggcggccgtactgctcttccagcgcggcttcgaggacctcgaggtgcaactg
tgggtgggtattctcggcctgcagtgcattccctacatcgccgccatcgcgtgtcaggtc
gcgtcctacatgccggaaggcaaggccgagacgccgctgccggccggcacgggcctgcag
acctga

DBGET integrated database retrieval system