KEGG   Azoarcus sp. DN11: CDA09_14895
Entry
CDA09_14895       CDS       T05691                                 

Definition
(GenBank) DNA ligase (NAD(+)) LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03410  Base excision repair
azd03420  Nucleotide excision repair
azd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_14895
   03410 Base excision repair
    CDA09_14895
   03420 Nucleotide excision repair
    CDA09_14895
   03430 Mismatch repair
    CDA09_14895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_14895
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_14895
Enzymes [BR:azd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     CDA09_14895
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     CDA09_14895
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     CDA09_14895
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CDA09_14895
   MMR (mismatch excision repair)
    DNA ligase
     CDA09_14895
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CDA09_14895
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD PTCB-BRCT HHH BRCT_2 5_3_exonuc UVR
Other DBs
NCBI-ProteinID: AYH44659
UniProt: A0A3Q8HTU9
LinkDB
Position
complement(3246835..3248868)
AA seq 677 aa
MIASALEFERAARLRRELEAHNHAYYVLDAPTVPDAEYDRLFRELEALERDYPELATPDS
PTQRVGGAPMPELAAVRHAVPMLSIRTETDTTNGGVIAFDTRVRNALGLGPADAPVEYLG
ELKFDGLAISLRYEHGVLVRAATRGDGETGEDVTHNVRTIRQIPLRLSGKPPALLEVRGE
IYMRRDDFQRLNARQEQAGEKLFINPRNTAAGAVRQLDPRIAAKRPLSFFAYGLGETGDW
ALPPTQAALLDAFAAFGLPVCEHRVVAVGVDGLCEFHDRIAALRDSLPYDIDGVVYKVNR
FDLQRELGFVTREPRWAVAHKYPAQEEITELLDIEVQVGRTGALTPVARLKPVFVGGVTV
TNATLHNEEEILRKGVLIGDQVIVRRAGDVIPEVVGPIVERRKGGERAFVMPTRCPVCAS
HVEKAEDEVVARCTGGLFCPAQRKQALLHFAGRRAMDIEGLGDKLVDQLVEAGIVKTPAD
LYRLGVLALANLPRMAEKSAANLLAAIEKSRHTTLARFIFALGIRNVGEATAKDLARHFG
ALDALMEATSERLVEVPDVGPVVAQSIARFFAEAHNREVIEQLRAAGVTWEEGAPAAPVA
GSASGKVFVLTGTLPTLSRDEAKALIEAHGGKVSGSVSKKTDYVVAGEEAGSKLAKAEEL
GVAILDQDGLLRLLEQG
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgatcgcttcggccctggaattcgagcgcgccgcccggttgcggcgcgagctcgaagcg
cacaatcacgcctattacgttctcgacgcgccgacggtcccggacgccgaatacgaccgg
ctgttccgcgagctggaggcgctggagcgcgactaccccgagctggcgacacccgattcg
ccgacgcagcgggtcggcggtgcgccgatgcccgaactggcggcggtgcggcacgcggtg
ccgatgctgtcgatccgcaccgagaccgacaccacgaacggtggcgtgatcgcatttgac
acgcgcgtgcgcaacgcgctgggactgggccccgcggatgcgcccgtggagtatctcggc
gaactgaagttcgacggcctggccatcagcctgcgctacgagcacggcgtgctggtgcgt
gcggcgacgcgcggcgacggcgagaccggcgaggacgtgacgcacaacgtgcgcacgatc
cgccagattccgctgcgcctgtcgggcaagccgcccgcgctgctggaagtgcgcggtgag
atctacatgcgccgcgacgatttccagcgcctgaatgcgcgccaggagcaggccggggag
aagctcttcatcaacccgcgcaatacggcggcgggcgcggtgcgccagctcgacccgcgc
atcgccgcgaagcgcccgctgtcctttttcgcctacggactgggcgaaaccggcgactgg
gcgctgccgccgacgcaggcggcgctgctcgacgcgtttgcggccttcggcctgccggtg
tgcgagcaccgggtcgtcgcggtcggcgtcgacgggctgtgtgaattccacgaccgcatc
gcggcgctgcgcgacagcctgccgtacgacatcgacggggtcgtgtacaaggtcaaccgc
ttcgatctgcagcgcgaactcggcttcgtgacgcgcgaaccgcgttgggcggtcgcgcac
aagtacccggcgcaggaagagatcaccgaactcctcgacatcgaggtgcaggtcggccgc
accggtgcgctgacgccggtcgcacgcctgaagccggtgttcgtcggcggcgtcacggtg
accaacgcgaccctgcacaacgaagaggaaatcctgcgcaagggcgtgctgatcggcgat
caggtcatcgtacggcgggccggcgacgttatacctgaggtcgtcggtccgatcgtcgaa
cggcgcaagggcggcgagcgggccttcgtgatgccgacccgttgcccggtgtgcgcgtcg
cacgtcgagaaggccgaggacgaagtggtggcgcgctgcacgggcgggctgttctgtccc
gcgcagcgcaagcaggccctgctgcatttcgccgggcggcgcgcgatggacatcgagggt
ctgggcgacaagctggtcgaccagctcgtcgaggccggcatcgtgaagacgccggcggac
ctctacaggctgggcgtgctggcgttggcgaacctgccgcgcatggccgagaagtcggcg
gccaacctgctcgcggcgatcgagaagagccggcatacgacgctcgcgcgcttcatcttc
gcgctcggcatccgcaatgtcggcgaagcgacggcgaaggatctggcgcggcatttcggc
gcgctcgacgcgctgatggaggcgacgtccgagcggctggtggaagtgccggatgtcggc
ccggtggtggcgcagagcatcgcgcgcttcttcgccgaggcgcacaaccgcgaggtgatc
gagcaattgcgcgcggcgggcgtgacatgggaagaaggcgcgccggcagcgccggtggcg
ggcagcgccagcggcaaggtcttcgtgctgaccggcacgctgccgacgctgagccgcgac
gaggcgaaggcgctgatcgaggcgcacggcggcaaggtcagcgggtcggtgtcgaagaag
acggattacgtggttgcgggcgaggaagccggttccaagctcgcgaaggcggaagaactg
ggcgtggcgatcctcgatcaggacggcttgctgcgcctgctcgaacaaggttga

DBGET integrated database retrieval system