KEGG   Azoarcus sp. DN11: CDA09_15420
Entry
CDA09_15420       CDS       T05691                                 

Gene name
holB
Definition
(GenBank) DNA polymerase III subunit delta'
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03030  DNA replication
azd03430  Mismatch repair
azd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDA09_15420 (holB)
   03430 Mismatch repair
    CDA09_15420 (holB)
   03440 Homologous recombination
    CDA09_15420 (holB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azd03032]
    CDA09_15420 (holB)
   03400 DNA repair and recombination proteins [BR:azd03400]
    CDA09_15420 (holB)
Enzymes [BR:azd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CDA09_15420 (holB)
DNA replication proteins [BR:azd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CDA09_15420 (holB)
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     CDA09_15420 (holB)
SSDB
Motif
Pfam: DNA_pol3_delta2 DNApol3-delta_C AAA_16 AAA QueC AAA_5 AAA_22
Other DBs
NCBI-ProteinID: AYH44755
UniProt: A0A3S7UIM8
LinkDB
Position
complement(3352435..3353499)
AA seq 354 aa
MIHPWLQETWQRLVGLGARLPHALLFVGPEGLGKRDLADALAARLLCATPGADGHACGHC
AACQLRLSGNHPDLLPVVPEADAASGKEPGDGDDAGEGEGGSGKKKSSQIRIEQIRDLQE
ALAVTGHQSSRRVIVVDPAEAMNAFTANALLKLLEEPPEGCVFLLVSSAPRRLLPTIRSR
CQQWSFSRPAGEAVAQWLSASEAPPADLLALTGGMPLAAQRLARNGSDALLRRFVKDLAQ
LPAGDPLKLAGQWESWLKSKEALAAGFGMPQLVEWMQRWVTDLASLRLGGRVRFFPGEDG
VIAALAQRTSVATVTNCYNELARIRRVAQHPLNARLMLEDMLLRYARAVTGTRR
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgatccacccttggctgcaggagacctggcagcggctggtcggcctcggcgcacggctg
ccgcacgcgctcctcttcgtcggcccggaaggcctcggcaagcgcgacctcgccgacgcg
ctcgcggcacgcctgctgtgcgcgaccccgggcgcggacgggcacgcctgcggccactgc
gcggcctgccaactgaggctctcgggtaaccatcccgacctgctgcccgtcgttccggaa
gccgatgcggcgtccgggaaagagccaggggacggtgatgatgcgggtgagggcgaaggc
ggcagcggcaagaaaaaatcctcgcagatccggatcgagcagatccgcgacctgcaggaa
gcgctcgccgtgaccggccaccagagcagccggcgcgtgatcgtcgtcgatcccgccgaa
gcgatgaacgccttcaccgccaacgccctgctgaagctcctcgaagagccgccggaaggc
tgcgtcttcctgctcgtctcgtcggcgccgcgccgcctgctgcccacgattcgcagccgt
tgccagcagtggagcttctcgcgccccgccggcgaggccgtcgcgcagtggctctcggcc
tcggaagccccgcccgcggacctgctcgccctcacgggcgggatgccgctcgcggcgcag
cgcctcgcccgcaacggctcggacgcgctgctgcggcgcttcgtgaaggatctcgcccag
ttgcccgccggcgatccgctgaaactcgccggccagtgggaaagctggctcaagtcgaag
gaagcgctcgccgccggcttcggcatgccgcagctcgtcgaatggatgcagcgctgggtc
accgacctcgcgtcgctgcggctgggcgggcgcgtgcgcttcttccccggcgaggacggt
gtcatcgccgcgctcgcccagcgcacgagcgtggccaccgtgacgaactgctacaatgaa
ctcgcccggatccgccgggttgcacagcatccgctgaatgcccggctgatgctcgaagac
atgctcctgcgctatgcgcgcgccgtgaccggaacccgccgatga

DBGET integrated database retrieval system