KEGG   Azoarcus sp. DN11: CDA09_15860Help
Entry
CDA09_15860       CDS       T05691                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
azd  Azoarcus sp. DN11
Pathway
azd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:azd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CDA09_15860
Enzymes [BR:azd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CDA09_15860
DNA repair and recombination proteins [BR:azd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CDA09_15860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AYH44841
LinkDB All DBs
Position
complement(3447734..3450520)
Genome map
AA seq 928 aa AA seqDB search
MPRGHEAVPPARRAKGQPAADPPGELGEYAAKRTFAATPEPAPAVPQAGGGPLLFVIQQH
SARRLHFDFRLECDGVLKSWAVPKGPSLDPAEKRLAVQTEDHPYDYASFEGVIPPGQYGA
GEVIVWDCGVYSPDEDQAYSFDDRDEAQRRVREGLAQGKLSFLLRGEKVKGSFALVRTSE
PRNWLLIKHKDRFAGPADPGARNRSVLSGLMVEELKVLPVRRIPVATLVPGGRPEAMPAT
LSPMLAETGEAPFADADWLWEPKLDGYRVLAFVSGERAKIRVKLLSRRGLDLTATFPRLA
AELCGQGADMILDGEIVAFDAAGRPSFNALQNRFQLKTERDIATADRSTPVVFCCFDLLH
FAGVDLRGAPYRDRRRYLAQCLLPSPLLQLVHVAEDGEALHGAALASGFEGVVGKRKDSR
YEAGRRSASWLKIKAAQSAEFVVGGYTRGKGSRAPLGALLIGYRDGGVLRYASHVGSGFD
AATLAQVRARLEGLRTDACPFAEPPELNGPTTWVVPEMVVEVQFQAWTEDGSLRAPVFLR
VRDDIDPRTVRRSGHRPQVPHAAGAPGAEGGSGEIDEILRQLENGKAAFPLAVGPHRIRL
THLDRVYWPADPALRQPALTKRDLLRYFAQVSPFLLPHLADRPLTLIRMPDGIGGQRFFQ
KHWEQERPGFVDTLTVFSEHKDESHEALVCNNLATLLWLAQSGTIELHVWHSRARAGADA
AVQGTDYAGSLASLEASVLNFPDYVVFDLDPYIYSGHEAPGAEPELNTAAFEKGKEVAFW
LHELLQGMALDAIVKTSGKTGLHVFVPIRRTIDFDAARKVCELVGRHLLRQHPRDITMEW
SVRARTGKIFLDYNMNVRGKTLNVAYSPRGVPGAPVSMPLTWDELAGAHPLDFRITNVAQ
RLAQSGDHWHDALERKQSLEKAVSGARS
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgggcatgaggcggttccgcccgcgcggcgggcaaagggacaacctgcggcc
gacccgcctggcgaactcggcgaatacgccgccaagcggactttcgctgccacgccggag
ccggcgccggcggtgccgcaggcaggcggagggccgttgctcttcgtgatccagcagcac
tcggcgcggcggctgcatttcgacttccggctcgaatgtgatggagtgctgaaatcctgg
gcagttcccaaggggccgtccctcgatcccgcggagaagcggcttgcggtccagaccgag
gatcatccctatgactacgcctcgttcgaaggcgtcatcccgcccgggcagtacggtgcc
ggggaagtgatcgtgtgggactgcggcgtttattcacccgacgaggatcaggcgtattcg
ttcgacgatcgggacgaagcgcagcggcgggtccgcgaagggctcgcgcagggcaagctg
agcttcttgctgcgcggagagaaggtgaagggctccttcgccctcgtccgcacgtcggag
ccgcgcaactggctgctgatcaagcacaaggaccgctttgcggggccggccgatcccggc
gcgaggaaccgctcggtactcagcggattgatggtcgaggagctcaaggtcctgccggtg
cgccgcattccggtggcgacgctggtgcctggcggcaggcccgaggcgatgcccgcgacg
ctctcgcccatgctcgccgagaccggcgaggcgccctttgctgatgccgactggctgtgg
gaaccgaagctcgacggttatcgcgtgctggccttcgtctccggggagagggcgaaaata
cgggtgaagctgctttcgcgccggggcctcgacctgaccgccaccttcccgcggctcgct
gcggaactgtgcggccagggggcggacatgatcctggatggagagatcgtggccttcgat
gcggccggccggccgtcgttcaatgcgctgcagaatcgcttccagctgaaaaccgaacgc
gacatcgccaccgccgaccgcagcacgccggtggtgttctgctgcttcgacctgctgcac
ttcgcgggcgtcgacctgcgcggagcgccgtatcgcgaccgccgccgctacctcgcccaa
tgcctgctgccttcgcccctgctgcagctcgtccatgtcgcggaggacggggaggcgctg
catggagcggcgctcgccagcggcttcgagggggtggtcggcaagcgcaaggacagccgc
tacgaggccggccggcgctcggcatcgtggctcaagatcaaagccgcgcagagcgcggag
ttcgtggtcggcggctacacgcgcggcaagggatcgcgggcacccctgggcgcgctgctg
atcgggtaccgggatgggggcgtgctgcggtacgcctcgcatgtcggatccggcttcgac
gccgcgacgctggcgcaggtcagggcgcgactggagggcttgcgaacggacgcctgcccg
ttcgcggagccgccggagctgaacggcccgacgacgtgggtcgtgccggagatggtggtc
gaagtgcagttccaggcgtggaccgaggacggtagcctgcgcgcgccggtttttctgcgt
gtgcgcgacgacatcgacccccggacggtgcggcgttccgggcacaggccgcaggtgccg
cacgcagcgggagcgccgggcgcggaggggggaagcggcgagatcgacgagatcctgcgg
caactggagaacggcaaggcggcctttccgctcgcggtcgggccgcaccggatccggctg
acgcatctcgatcgcgtctactggccggcggatccggcactcaggcaaccggcgctgacc
aagcgcgacctgctgcgctatttcgcacaggtttcgcccttcctcctgccgcacctcgcg
gaccgtccgctgacgctgatccgcatgcccgacggcatcggcgggcagcgattcttccag
aagcactgggagcaggagcggccggggttcgtggacaccctcacggtgttttccgagcac
aaggacgagagccatgaggcgctcgtgtgcaacaacctggcgacgctgctgtggcttgcg
cagtcgggcacgatcgagctccacgtctggcattcgcgggcacgcgccggggcggatgcg
gcggtgcaggggaccgactacgccggatcgctcgcctccctggaggcctcggtgctcaac
tttcccgactacgtggtgttcgacctcgacccctacatctattccggccacgaggcgccg
ggggcagagccggagctcaacacggccgccttcgagaagggcaaggaggtcgccttctgg
ctgcacgaactgctgcagggcatggcgctcgacgcgatcgtcaagacctcgggcaagacc
gggctgcatgtcttcgtgccgatccggcgcacgatcgatttcgatgccgcgcgcaaggtg
tgcgaactcgtcgggcggcacctgctgcgccagcatccgcgggacatcacgatggagtgg
agcgtgcgcgcgcggaccggcaagatcttccttgactacaatatgaacgtccgcggcaag
accctgaacgtcgcctattcgccccgcggggtgcccggcgcgccggtgtcgatgccgctc
acctgggacgagctggccggcgcgcacccgctcgacttcaggatcaccaacgtcgcgcag
cgcctggcgcaatcgggtgatcactggcacgacgccctggagcgcaagcagagtctggaa
aaggccgtgtcgggcgccagatcatga

DBGET integrated database retrieval system