KEGG   Azoarcus sp. DN11: CDA09_21415
Entry
CDA09_21415       CDS       T05691                                 

Definition
(GenBank) 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00362  Benzoate degradation
azd00622  Xylene degradation
azd00643  Styrene degradation
azd01100  Metabolic pathways
azd01120  Microbial metabolism in diverse environments
azd01220  Degradation of aromatic compounds
Module
azd_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDA09_21415
   00622 Xylene degradation
    CDA09_21415
   00643 Styrene degradation
    CDA09_21415
Enzymes [BR:azd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     CDA09_21415
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Thioesterase Abhydrolase_2 Esterase FSH1
Other DBs
NCBI-ProteinID: AYH45911
UniProt: A0A3S7ULN7
LinkDB
Position
complement(4614372..4615196)
AA seq 274 aa
MTNVEIGKEIVAAGIKTNYHELGTGEPVFLIHGSGPGVSAYANWRLVLPTLGQLFRVIAP
DMAGFGFTERPKNYIYSKDNWVEHIIGMLDALKIERADFIGNSFGGALAIATAVKHPDRI
GRLVLMGAAGTHFELTPGLDAVWGYTPSIEKMRNLLDIFAFDRSLVNDELAKLRYEASIR
PGFQESFGSMFPAPRQRWVDALASSDEQIRNLANEVLLIHGRDDQVVPLSSSLRLFQLLE
NVQLHSFARCGHWVQIEAANDFCRLVVDFLSKPH
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaccaacgtagaaattggaaaggaaatcgtcgctgctggaattaagaccaattatcac
gagctcggaactggagagcctgtatttcttattcacggatcgggtccaggtgtcagcgct
tatgcaaattggcgcttggtgttgccaacactggggcaattatttcgcgtcatagcaccg
gatatggcagggttcggttttacagagcgcccgaagaattacatctactcaaaggataat
tgggttgagcacatcataggtatgcttgacgcattgaaaatcgagcgtgcagattttatt
gggaattctttcggtggtgcccttgcaatcgcaaccgccgttaagcaccccgaccgcatt
ggccgtttggtcttgatgggcgcagctggaacacatttcgaacttacccctgggctggat
gcagtttggggttatacgccgtcaattgaaaaaatgcgcaacctgctggatatatttgcc
tttgatcgttcgcttgtgaatgatgaacttgcaaaactgcgttatgaggcaagcattcgg
ccaggctttcaagagtcattcggcagtatgttccccgctcctcggcagcgctgggttgac
gcactggcgagctcggatgagcaaattcgcaacctcgcgaatgaggtgctcttgattcac
ggccgtgatgaccaggtggtaccactgtcaagcagtcttcgtctttttcaactattggag
aacgtccagttgcattcttttgctcgctgtgggcactgggtgcaaattgaagccgccaat
gacttttgtagattggttgtagactttcttagcaagccgcattga

DBGET integrated database retrieval system