KEGG   Azoarcus sp. CIB: AzCIB_0099Help
Entry
AzCIB_0099        CDS       T04019                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00970  Aminoacyl-tRNA biosynthesis
azi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AzCIB_0099
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:azi03029]
    AzCIB_0099
Enzymes [BR:azi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AzCIB_0099
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AzCIB_0099
Mitochondrial biogenesis [BR:azi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AzCIB_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AKU10004
UniProt: A0A0K1IZY3
LinkDB All DBs
Position
complement(116838..118295)
Genome map
AA seq 485 aa AA seqDB search
MSRSDWEVVIGLEVHAQLNTASKIFSGASTAFGAEPNVQACAVDIALPGVLPVLNRGAVE
RAIRFGLAIGANVAAKSVFARKNYFYPDLPKGYQISQFELPVVQGGEITIRVGEGEKAYE
KTVQLTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARALH
ALVRWIDICDGNMQEGSFRCDANVSVRHPGGPLGTRREIKNLNSFRFLQQAIDFEVQWQI
ATIEDGGKIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLVIAPEWKARVQSEM
PELPGAMKARFIEQWGLSAYDATTLTASKEIASFYQATVEAAGVPLAKPCANWVMGDLAA
RLNKAELDASASPVSPAQLAGLVQRIADGTISNNIGKKVFEALWNGEGASADAIIEAQGL
RQTNDAGAIEAMIDEVLAANQKSVEEFRAGKEKAFNALVGQVMKASKGKANPAQVNELLK
RKLEG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcagatcggattgggaagtcgtcatcgggctggaagtgcatgcccagctcaacacc
gcgtcgaagatcttttccggcgccagcaccgccttcggcgccgagccgaacgtgcaggcc
tgcgccgtcgacatcgcgctgcccggcgtgctgccggtgctgaaccgcggcgccgtcgag
cgcgcgatccgcttcggcctcgcaatcggcgcgaacgtcgcggcgaagagcgtgttcgcg
cgcaagaactacttctacccggatctgccgaagggctaccagatcagccagttcgagctg
ccggtggtgcagggcggcgaaatcacgatccgcgtcggtgaaggggagaaagcctacgag
aagaccgtgcagctaacgcgcgcccatctcgaggaagacgccggcaagtccctgcacgag
gacttccacggcatgagcggcatcgacctcaaccgtgccggcacgccgctgctggaaatc
gtctccgaacccgacatgcgctcctcggccgaggcggtcgcctacgcccgcgcgctccat
gcgctggtacgctggatcgacatctgcgacggcaacatgcaggaaggctcgttccgctgc
gacgccaacgtctccgtgcgccaccccggcgggccgctcggcacgcgccgcgagatcaag
aacctgaactccttccgcttcctgcagcaggccatcgacttcgaagtgcagtggcagatc
gccaccatcgaggacggcggcaagatccagcaggcgaccgtgctgttcgatcccgacacc
ggcgagacgcgcatgatgcgctcgaaggaagacgcccacgactaccgctatttccccgat
cccgacctgctgccactggtgatcgcgccggaatggaaagcgcgcgtgcagtcggagatg
cccgagctgccgggcgcgatgaaagcccgcttcatcgagcaatggggcctctcggcctac
gacgcgacgacgctcaccgcctcgaaggaaatcgcgtccttctatcaagccaccgtcgaa
gccgccggcgtgccgctcgccaagccctgcgccaactgggtcatgggcgatctcgccgcc
cgtctcaacaaggccgaactcgacgcttccgcgtccccggtctcgcccgcccagctcgcc
ggcctcgtgcagcgcatcgccgacggcaccatctcgaacaacataggcaagaaggtgttc
gaagccctgtggaacggcgagggtgccagtgcggacgccatcatcgaagcccagggcctg
cgccagaccaacgacgccggcgcgatcgaggcaatgatcgacgaagtcctcgcggcgaac
cagaagtcggtcgaggagttccgcgccggcaaggagaaggccttcaacgcgctcgtcggc
caggtcatgaaggcgagcaagggcaaggccaacccggcgcaggtcaacgaactgctgaaa
cgcaagctggaaggctga

DBGET integrated database retrieval system