KEGG   Azoarcus sp. CIB: AzCIB_0541Help
Entry
AzCIB_0541        CDS       T04019                                 

Definition
(GenBank) fused malic enzyme predicted oxidoreductase/predicted phosphotransacetylase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00620  Pyruvate metabolism
azi00710  Carbon fixation in photosynthetic organisms
azi01100  Metabolic pathways
azi01120  Microbial metabolism in diverse environments
azi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AzCIB_0541
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AzCIB_0541
Enzymes [BR:azi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     AzCIB_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AKU10446
UniProt: A0A0K1J132
LinkDB All DBs
Position
627736..630012
Genome map
AA seq 758 aa AA seqDB search
MDELIRAAALDYHRYPRPGKISVTPTKVLSNQRDLSLAYSPGVAAACDAIVEEPGEAANL
TARSNLIGVVTNGTAVLGLGNIGPLAAKPVMEGKGVLFKKFAGIDVFDLEIAENDPDKLI
DMIAALEPTFGGINLEDIKAPECFYIESRLRERMKIPVFHDDQHGTAIVVGAAILNGLHL
LGKDLKKVKLVTSGAGAAALACLGLLEKLGIPVENIWVTDLEGVVYEGRTALMDPIKARY
AKATSARKLAEVIEGADVFLGLSAGGVLKPEMVAKMAAQPMILALANPTPEILPELVKSV
RDDAIIATGRSDYPNQVNNVLCFPFIFRGALDVGATTITDEMQLAAVKAIAELARAEQSD
IVAAAYGEKVSGFGPEYIIPRPFDPRLIVKIAPAVAEAGMASGVATRPITDWDAYRTQLN
NFVWHSGLIMKPVFAAARGTNQRIIFAEGESERVLRAVQTVVDEGLARPILIGRPDVLSA
NIERFGLRMRAEEHFELVNPDFDPRFKELWTSYHGLTERQGVSVEYAKKEVRRRTTLIGA
LLLKQGYGDGLICGTYGMHRLHLDFIEKVIGRREGVKHCYALNVVNLPERTLFLADTYIN
YDPSPEQIVEMTLLACEEMSRFGMTPKVALLSHSSFGSADSPTAEKMRAALRLLHERHPE
LEVEGEMHGDAALDAELRLRIFPNARMRDAANLLIFPTLDAANIAFNLLKTAAGEGMTVG
PILLGAARPVHILTPSATVRRIVNMTALTAVEAAQRKS
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggacgaattgatccgcgctgcggcgctcgactatcaccgttatccgcggccgggcaag
atctcggtcacccccacgaaagtactttccaaccagcgcgacctgtccctggcttattcg
ccgggcgtcgccgccgcgtgcgacgcgatcgtcgaggagcctggcgaggccgcgaacctg
accgcgcgcagcaacctgatcggcgtcgtcaccaacggcaccgccgtgctgggcctgggc
aacatcggcccgctcgccgccaagccggtcatggaaggcaagggcgtgctgttcaagaaa
ttcgcgggcatcgacgtgttcgacctggagatcgccgagaacgaccccgacaagctgatc
gacatgatcgcggcgctggagcccaccttcggcggcatcaacctcgaggacatcaaggcg
ccggagtgcttctacatcgagtcgcgcctgcgcgagcggatgaagattccggtcttccac
gacgaccagcacggcacggcgatcgtcgtcggcgcggcgatcctcaacggcctgcatctg
ctcggcaaggacctgaagaaggtcaagctcgtgacttccggcgcgggggctgcggcgctc
gcctgcctgggcctgctcgagaagctcggcattcccgtcgagaacatctgggtcaccgac
ctcgaaggcgtcgtgtacgagggccgcacggccctgatggacccgatcaaggcgcgttac
gcgaaggccaccagcgcccgcaagctcgccgaggtcatcgagggcgcggacgtgttcctc
ggcctgtcggccggcggcgtgctcaagccggagatggtcgcgaagatggcggcgcagccg
atgatcctcgcgctcgccaatccgacgccggagattctgcccgaactggtgaagtcggtg
cgggacgacgcgatcatcgcgacgggccgttcggactacccgaaccaggtcaacaacgtg
ctgtgcttccccttcatcttccgcggcgcgctcgacgtcggcgcgaccacgatcaccgac
gagatgcagctcgccgccgtcaaggcgatcgccgagctcgcgcgcgccgagcagagcgac
atcgtcgccgccgcctacggcgagaaggtgtctggcttcgggcccgaatacatcatcccg
cgtcccttcgacccgcgcctgatcgtcaagatcgccccggcggtcgcggaggccggcatg
gcctccggtgtcgcgacgcgcccgatcaccgactgggacgcctaccgtacccagctcaac
aatttcgtgtggcattcgggcctcatcatgaagcccgtgttcgctgccgcgcgcggcacg
aaccagcgcatcatcttcgccgaaggcgagtccgagcgcgtgctgcgcgcggtgcagacg
gtcgttgacgaaggcctcgcgcgcccgatcctgatcggccgccccgatgtcttgagtgcc
aacatcgagcgcttcggtctgcgcatgcgtgccgaagaacatttcgagctcgtgaacccc
gatttcgatccccgcttcaaggagctgtggacctcctaccatggcctgacggagcgccag
ggcgtgtcggtcgagtacgcgaagaaggaagtgcgccgccgcacgacgctgatcggcgcg
ctgctgctcaagcagggctacggcgacggcctgatctgcggcacctacggcatgcaccgg
ctgcacctcgacttcatcgagaaggtcatcggccggcgcgagggcgtgaagcactgctac
gcgctcaacgtcgtgaacctgcccgagcgcacgctgttcctcgccgacacctacatcaac
tacgacccgtcgcccgaacagatcgtggagatgacgctgctggcgtgcgaggagatgtcg
cgcttcggtatgacgcccaaggtcgcgctgctgtcgcactcgtccttcggtagcgccgat
tcgccgaccgccgagaagatgcgcgccgcgctgcgcctgctgcacgagcgtcatcccgaa
ctcgaggtcgagggcgagatgcacggcgatgcggcgctcgacgccgaattgcgcctgcgc
atcttccccaatgcgcgcatgcgcgatgccgccaacctgctgatcttcccgacgctggat
gctgccaacattgccttcaacctgctcaagactgcggcgggcgaaggcatgacggtcggt
ccgatcctgctcggcgcggcgcgtccggtgcatatcctgacgccctcggcgaccgtgcgc
cgcatcgtcaacatgaccgccctcacggcggtcgaagcggcacagcgcaagtcctga

DBGET integrated database retrieval system