KEGG   Azoarcus sp. CIB: AzCIB_1041Help
Entry
AzCIB_1041        CDS       T04019                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AzCIB_1041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azi02000]
    AzCIB_1041
Enzymes [BR:azi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AzCIB_1041
Transporters [BR:azi02000]
 Other Transporters
  Pores ion channels [TC:1]
   AzCIB_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_N_2 GST_C_2 Tom37 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AKU10946
UniProt: A0A0K1J2G8
LinkDB All DBs
Position
complement(1176183..1176788)
Genome map
AA seq 201 aa AA seqDB search
MKLYLKPGACSLSPHIVLEEAGLKYDMEVVDLQTKVTTSGADYWKINPKGYVPALQLDNG
EVITEGPAIVQYLADQVPGKKLAPANGTIERYKLQAWLTFIGTEIHKTFSPFFNPATPAE
WKAMCRANLERRFGYVAEQLAGKDYLMGADFSVADAYLFTVMGWAKYIELDLSQWPALAA
YQARVAARPAVVAAMKAEGLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtatttgaaacccggtgcatgctcgctctctccccacatcgtcctcgaggag
gcgggcctgaagtacgacatggaagtcgtcgacctacagacaaaggtcaccacatcgggc
gcggattactggaagatcaaccccaagggctacgttcccgcgctgcagctcgacaacggc
gaagtgatcaccgaaggccccgcaatcgtccagtacctcgccgaccaggtaccgggcaag
aagctcgctccggccaacggcaccatcgagcgctacaagctgcaggcttggctcaccttt
atcggcaccgaaatccacaagaccttcagccccttcttcaacccggcgacgcccgccgag
tggaaggccatgtgccgcgcgaacctcgaacgccgcttcggctacgtggccgaacagctc
gcgggcaaggactacctgatgggcgcggatttcagcgtcgccgacgcctacctgttcacg
gtgatgggctgggcgaagtacatcgaactcgacctgtcgcagtggccggcgctcgccgcc
taccaggcccgcgtcgccgcccgcccggcggtcgtcgcagcgatgaaggccgaagggctg
ctgtga

DBGET integrated database retrieval system