KEGG   Azoarcus sp. CIB: AzCIB_1093Help
Entry
AzCIB_1093        CDS       T04019                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00030  Pentose phosphate pathway
azi01100  Metabolic pathways
azi01120  Microbial metabolism in diverse environments
azi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AzCIB_1093
Enzymes [BR:azi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AzCIB_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AKU10998
UniProt: A0A0K1J365
LinkDB All DBs
Position
1235630..1237477
Genome map
AA seq 615 aa AA seqDB search
MGWNRKVLRVNLTQGTCKEEPLNMEWANEYLGSRGLSAKYLVSEIDPKVDPLSPDNKLIM
ATGPLTGTMASTGGRYTVTCKGPLTGAIACSNSGGFFGAEMKFAGWDMVIFEGKSPKPVY
LFIENDKAELRDASHLWGTSCWHTEEQIKADHQDPLIRVSSIGKAGENLVLFAVVINDLH
RAAGRSGVGAVMGSKNLKAVAIRGTKGVSGIKDFPAFLKATTEAKKVLADNAVTGQGLPK
FGTQVLMNVINEIGALPTRNHRDVQFEDASKISAEAMHEKRESDGKSHLITNAACFGCTI
ACGRISQIDKNHFTVKNSPQYWGASGGLEYEAAWALGAANGVGDLEALQYANLLCNEQGF
DPITFGATVAAAMELYEMGVLTKEQLGLDAPFGSAQALAKLAEMTAAGEGFGKELGQGSA
RMCAKYGHPELSMSVKKQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPLVTDGKAELVKAFQDATAVFDAAGICVFTSFAWTLADVQPQLAAACGEEWTMDKLNA
VGERIWNLERQFNNAAGFTSKDDNLPPRLLTEPAKTGPAKGLVNGLDKMLPEYYKVRGWT
PDGVPTAETLERLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggatggaatcgcaaagtcctgcgggtgaacctgactcagggcacgtgcaaggaagaa
ccgctcaatatggagtgggccaacgaatacctcggctcgcgcggcttgtcggccaagtat
ctggtctcggaaatcgaccccaaggtcgatccgctatcgcccgacaacaagctgatcatg
gcgaccggcccgctcactggcacgatggcctcgaccggggggcgctacaccgtcacttgc
aaggggccgctcaccggcgcgatcgcctgttcgaactcgggcggcttcttcggcgccgag
atgaagttcgccggttgggatatggtcatcttcgagggcaagtcgccgaagcccgtctac
ctcttcatcgagaacgacaaggccgagctgcgcgacgcctcgcacctgtggggcacgagc
tgctggcataccgaggagcagatcaaggccgaccaccaggaccccctgatccgcgtgtcg
tcgatcggcaaggcgggcgagaacctggtgctgttcgcggtcgtgatcaatgacctgcac
cgcgcggccgggcgctccggtgtcggcgccgtgatgggttcgaagaacctcaaggcggtg
gcgatccgcggtaccaagggcgtgtccgggatcaaggacttcccggccttcctcaaggcc
acgaccgaagcgaagaaggtgctcgccgacaacgcggtgaccggccaggggctgccgaaa
ttcggtacccaggtgctgatgaacgtcatcaacgaaatcggtgcgctgcccacccgcaac
caccgcgacgtgcagttcgaggatgcctccaagatctccgccgaggcgatgcacgagaag
cgtgaatccgacggcaagagccacctcatcaccaacgcagcgtgcttcggctgcacgatc
gcctgcgggcgcatctcgcagatcgacaagaaccacttcacggtcaagaacagtccgcag
tactggggtgcgtccgggggcctggaatacgaagccgcgtgggcgctcggtgccgccaac
ggcgtcggcgatctcgaagccctgcagtacgccaacctgctgtgcaacgaacagggtttc
gacccgatcaccttcggtgccaccgtcgctgcggcgatggagctgtacgagatgggtgtc
ctgaccaaggagcaactcggcctcgatgcgccgttcggctcggcccaggcgctggcgaag
ctcgccgagatgaccgcggccggcgaaggcttcggcaaggaactcgggcaaggctcggca
cgcatgtgtgccaagtacggccacccggaactgtcgatgagcgtcaagaagcaggaattt
cctgcctacgactcgcgcggcatccagggcatgggcctcgcgtacgccacctctaaccgc
ggcgcctgccacctgcgcggctacacggtcgcgtccgaagtgctgggcatccccgtcaag
accgacccgctcgtcaccgacggcaaggcagagctcgtcaaggccttccaggatgccacc
gcggtgttcgacgcggccgggatctgcgtgttcacgtccttcgcgtggacgcttgccgac
gtgcagccgcaactcgcggcggcctgtggcgaggaatggacgatggacaagctcaacgcc
gtcggcgagcgcatctggaacctcgagcgccagttcaacaatgcggccggcttcaccagc
aaggacgacaatctgccgccgcgcctgctgaccgaaccggccaagaccggtccggccaag
gggctcgtcaacggcctcgacaagatgttgcccgagtactacaaggtgcgcggctggacg
ccggacggcgtgccgacggcggaaacgctggagcgactgggactctga

DBGET integrated database retrieval system