KEGG   Azoarcus sp. CIB: AzCIB_1948
Entry
AzCIB_1948        CDS       T04019                                 

Definition
(GenBank) cyclohex-1-ene-1-carboxyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00362  Benzoate degradation
azi01100  Metabolic pathways
azi01120  Microbial metabolism in diverse environments
azi01220  Degradation of aromatic compounds
Module
azi_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AzCIB_1948
Enzymes [BR:azi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     AzCIB_1948
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AKU11843
UniProt: A0A0K1J5L6
LinkDB
Position
2176730..2177524
AA seq 264 aa
MATGDDTMISVILTETRGKVGLIRINRPEVFNALNDDVMTGIGQALDRFEADPAIACVVV
TGSEKAFAAGADIAAMRTMDYMDAYKSDFITRNWERLKTFRKPTIAAVSGVALGGGCELA
MMCDIVFAAENARFGQPEIKIGTIPGAGGTQRLPRAVGKTKAMDLCLTGRLMDAQEAERS
GLVARIYPPESVLDEALAAAAKIAEFSLPVLMMMKETVNRAFEGPLNEGLLFERRTLHAT
FGLADQKEGMSAFVDKRPPRFADR
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcgacgggagacgacacgatgatctcggtgatcctcactgaaacgcgcggcaaggtc
ggccttatccgcatcaaccgcccggaagtcttcaacgcgctcaacgatgacgtgatgacc
gggatcggccaggcgctcgaccgcttcgaagcggatcccgccatcgcttgcgtcgtggtg
acgggctccgagaaggccttcgccgccggtgcggacatcgccgcgatgcgcacgatggac
tacatggacgcgtacaagtccgacttcatcacgcgcaactgggagcgtctcaagaccttc
cgcaagccgaccatcgccgccgtctcgggcgtcgcgctgggcggcggatgcgagctcgcg
atgatgtgcgacatcgtcttcgccgctgaaaatgcccgcttcgggcagccggagatcaag
atcggcacgatccccggtgcaggcggaacgcagcgcctgccgcgcgccgtgggcaagacc
aaggcgatggacctgtgcctgaccggtcgcctgatggacgcgcaggaagcggagcgcagc
ggcctggtcgcgcgcatctacccgcccgagagcgtgctcgacgaggcgctcgcagcagcc
gcgaagatcgccgagttctcgctgcccgtcctcatgatgatgaaggaaacggtgaatcgt
gccttcgaaggcccgctcaacgagggcctgctgttcgagcgccgcacgctgcacgcgacc
ttcgggctggcggaccagaaggaagggatgagcgccttcgtcgacaagcggccgccccgc
ttcgccgatcgctga

DBGET integrated database retrieval system