KEGG   Azoarcus sp. CIB: AzCIB_2410Help
Entry
AzCIB_2410        CDS       T04019                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00020  Citrate cycle (TCA cycle)
azi00190  Oxidative phosphorylation
azi00650  Butanoate metabolism
azi01100  Metabolic pathways
azi01110  Biosynthesis of secondary metabolites
azi01120  Microbial metabolism in diverse environments
azi01130  Biosynthesis of antibiotics
azi01200  Carbon metabolism
Module
azi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
azi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AzCIB_2410
   00650 Butanoate metabolism
    AzCIB_2410
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AzCIB_2410
Enzymes [BR:azi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AzCIB_2410
    1.3.5.4  fumarate reductase (quinol)
     AzCIB_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AKU12305
UniProt: A0A0K1J6Y9
LinkDB All DBs
Position
complement(2706327..2707022)
Genome map
AA seq 231 aa AA seqDB search
MRVSIYRFNPETDAKPRMQDYDVAPEAGDKKLLDVLMRLKTMDDSLSFRRSCREGVCGSD
AMNINGRNGLACLTSLPGLKEPVVLRPLPGFPVIRDLIVDMTQFFAHYHSIKPYLINNEV
PPERERLQSPAEREKLNGLYECILCACCSAFCPSFWWNPDKFIGPAGLLQAYRFISDSRD
TATAERLAYLDDVYRLYRCRSIMNCTEVCPKGLSPSHAIERIRLALVRESS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagtcagcatctaccgcttcaaccccgaaaccgacgcgaagccgcgtatgcaggat
tacgacgtcgcgcccgaggcgggcgacaagaagctgctcgacgtgctgatgcggctcaag
acgatggacgacagcctctcattccgccgttcctgtcgtgaaggcgtgtgcggatcggat
gcgatgaacatcaacggtcgtaacggactggcgtgcctcacgtcgctgccgggcctgaag
gagccggtcgtgctgcggccgttgccgggttttcccgtgatccgcgacctcatcgtcgac
atgacgcagttcttcgcgcattaccactcgatcaagccctacctcatcaataacgaggtc
cctcccgagcgcgaacgcctgcagtcgcccgcggagcgcgaaaagttgaacgggctgtac
gaatgcatcctgtgcgcgtgctgcagtgctttctgtccgtccttctggtggaatcccgac
aagttcatcggtccggcgggcctgctgcaggcgtaccgcttcatctccgactcccgcgac
acggcgactgcggagcggctcgcctacctggacgacgtatatcgcctgtaccgctgccgt
tcgatcatgaactgcactgaagtctgccccaaggggctgagtccgtcgcatgcgatcgaa
cgcatccggctcgcgctcgtgcgtgagtcttcgtag

DBGET integrated database retrieval system