KEGG   Azoarcus sp. CIB: AzCIB_3745Help
Entry
AzCIB_3745        CDS       T04019                                 

Definition
(GenBank) phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00630  Glyoxylate and dicarboxylate metabolism
azi01100  Metabolic pathways
azi01110  Biosynthesis of secondary metabolites
azi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AzCIB_3745
Enzymes [BR:azi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     AzCIB_3745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AKU13638
UniProt: A0A0K1JAJ7
LinkDB All DBs
Position
complement(4188112..4188789)
Genome map
AA seq 225 aa AA seqDB search
MSLARFPVRAVLFDLDGTLLDTIHDLADAANLMLAEMGRAARPLEQIHSFVGKGIPNLVR
RCMTEDAEAGEEEIEQAVVVFRRHYAVVNGRSTRIYPGVVETLEAMRAMELRLACVTNKA
EAFTLPLLERMGLTPYFAAVVSGDTLPVKKPDPAVLHHACELLGVRSPQALMIGDSANDA
LAARGAGMPVLLVTYGYSEGMPVDTIECDGLLSIATGALDRIEAA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcgcgcgcttcccggtgcgggcggtgctgttcgacctcgacggcaccctgctc
gacacgatccacgacctggccgacgcggccaacctgatgctcgccgagatgggccgtgcg
gcgcgcccgctcgaacagatccattccttcgtcggcaagggcatccccaacctcgtgcgc
cgctgcatgaccgaggatgccgaggcgggcgaggaggagatcgagcaggcggtcgtcgtg
ttcaggcggcattacgccgtcgtaaacggtcgcagcacgcgcatctaccccggcgtggtc
gagacgctggaggcgatgcgcgcgatggagctgcgcctggcctgcgtcacgaacaaggcc
gaggccttcacgctgccgctgctcgagcgcatgggcctgacgccgtatttcgctgcggtc
gtcagcggcgacacgctgccggtgaagaaacccgaccccgcggtgctgcaccacgcgtgc
gagctgctgggcgtgcggtcgccgcaggcgctgatgatcggcgattcggccaacgacgcg
ctcgccgcccgcggcgcggggatgccggtgctgctcgtgacctatggatatagcgaaggc
atgccggtggacaccatcgaatgcgatgggctactatcgatcgctaccggggcgctcgac
cgcatcgaagcggcgtga

DBGET integrated database retrieval system