KEGG   Azoarcus sp. CIB: AzCIB_3792Help
Entry
AzCIB_3792        CDS       T04019                                 

Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00550  Peptidoglycan biosynthesis
azi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AzCIB_3792
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AzCIB_3792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:azi01011]
    AzCIB_3792
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:azi03036]
    AzCIB_3792
Enzymes [BR:azi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AzCIB_3792
Peptidoglycan biosynthesis and degradation proteins [BR:azi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AzCIB_3792
Chromosome and associated proteins [BR:azi03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    AzCIB_3792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Ydc2-catalyt
Motif
Other DBs
NCBI-ProteinID: AKU13685
UniProt: A0A0K1JAQ2
LinkDB All DBs
Position
complement(4241439..4243193)
Genome map
AA seq 584 aa AA seqDB search
MSKQRTVTFNHNPLLRHGLPAWRPRVVMLGLMACSLALIGRAMYLQGVNDDFLQAKGESR
YARVLEVPATRGRVTDRHGDMLAVSTPVRSIWAIPTDVNLTPPDARKLAGLLEMDVQELN
RRLAAGRDFVYLKRQVSPETAQQIADLKLAGVHQQQEYRRYYPGGEVMAHMLGFTGVDDK
GQEGVELAFEGVLAGKAGARRVIRDRRGQIIEDVEAIRAPRDGQDLALSIDAKIQYLAYS
ALRQAMQTHKAKAGASVVLDARTGEVLALVNAPTYNPNNRTNLSGAQLRNRVLTDVYEPG
SIMKPFIVGLALDRGKVQPGTIIDTSPGRMTIGRATISDSHRNGALTVAQVIQKSSNIGT
VKVAMHFSPDEMWRLYDDLGFGKPLNLGFPGEAGGRLRPAKTWKPIEQATMSYGHGVSVS
LIQMAHAYLAFARDGELVPLSLTRLDAPPVGGKRIFSAATAREMRGMLELASAPGGTAPK
AQIAGYRVAGKTGTAIKLEGAHYTNKYVSSYVGLAPVSDPRLIVAVMIDEPSAGQYYGGA
VAAPVFAQITEGALRALGVAPDAPLVPLQLAQKQGIVVPSRENM
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacagcggacggtgaccttcaatcacaaccccttgctgcgccacggcctgcct
gcctggcgtccgcgcgtggtgatgctgggcctgatggcgtgctcgctggcgctgatcggg
cgcgcgatgtacctgcagggggtcaatgacgacttcctgcaggcgaagggcgaatcgcgc
tacgcgcgggtgctcgaggtgccggcgacgcgcggacgcgtcacggatcggcacggcgac
atgctggcggtgagcaccccggtgcgttcgatctgggcgattccgaccgacgtgaatctc
actccgccggacgcgcgcaagctcgcgggcctgctggaaatggacgtgcaggaactcaat
cgccgtctcgccgccgggcgcgatttcgtctacctgaaacgtcaggtgtcgcccgagact
gcacagcagatcgccgatctgaaactcgccggtgtccatcagcagcaggaatatcgccgc
tattaccctggtggtgaggtgatggcccacatgctgggcttcaccggcgtcgatgacaag
gggcaggagggcgtcgaactcgccttcgaaggtgtcctggccggcaaggcgggtgctcgg
cgagtgatccgcgaccgtcgcgggcagatcatcgaggacgtcgaagccatccgcgcgccg
cgcgacggacaggatctcgcgttgtcgatcgacgccaagatccagtacctcgcctattcg
gcgctgcgccaggcgatgcagacgcacaaggcgaaggccggcgcgtcggtggtgctcgat
gcgcgcaccggcgaggtgctcgcgctggtcaatgcaccgacctataacccgaacaatcgc
acgaacctcagcggggcacagctgcgcaaccgcgtccttaccgacgtgtatgaaccgggc
tcgatcatgaagcccttcatcgtcggcctcgcgctcgatcgcgggaaggttcagcccggc
acgatcatcgatacctcgccgggccgcatgacgatcgggcgcgcgacgatttccgattcg
caccgcaacggcgcgctgaccgtggcccaagtgatccagaagtcgtccaacatcggcacc
gtcaaggttgcgatgcatttctcgcccgacgagatgtggcggctgtacgacgatcttggt
ttcggcaagccgctgaacctcggcttccccggcgaggccggggggcgcctgcgtcccgcg
aagacgtggaagccgatcgaacaggcaacgatgtcttacggtcacggcgtttccgtgagc
ctcatccagatggcgcacgcctatctcgcgttcgcgcgcgatggcgagctggtgcccctg
tcgctgacccgtctcgacgcgccgccggttggtggcaagcgcattttctcggccgcgacg
gcgcgcgagatgcgcggcatgctcgagctggcgtccgctcccggtggcaccgcgcccaag
gcgcagatcgcgggctaccgcgtggcgggcaagaccggtacggcgatcaagctggaaggg
gcgcactacacgaacaaatatgtatcgtcctatgtcggactggccccggtctccgacccc
cggcttatcgttgccgtgatgatcgacgaaccgtctgcgggacagtattacggcggtgcg
gttgcggcgccggtgtttgcccagattaccgaaggcgcgctgcgtgcgctcggcgtggcg
cccgacgccccgttggtgccgctgcaactcgcgcagaagcaggggattgtcgtgccttcg
cgggagaacatgtga

DBGET integrated database retrieval system