KEGG   Azoarcus sp. CIB: AzCIB_4408
Entry
AzCIB_4408        CDS       T04019                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K10222  2,6-dioxo-6-phenylhexa-3-enoate hydrolase [EC:3.7.1.8]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00621  Dioxin degradation
azi01100  Metabolic pathways
azi01120  Microbial metabolism in diverse environments
azi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    AzCIB_4408
Enzymes [BR:azi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.8  2,6-dioxo-6-phenylhexa-3-enoate hydrolase
     AzCIB_4408
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Esterase DUF915 Abhydrolase_5 Peptidase_S9
Other DBs
NCBI-ProteinID: AKU14301
UniProt: A0A0K1JC77
LinkDB
Position
complement(4907118..4907975)
AA seq 285 aa
MNQYTESTTSRFAKINEKGFEDFQVHFNEAGDGEAVIMLHGGGPGAGGWSNYSRNLGPLV
QAGYRVILKDSPGFNKSDPVVMDEQRGLVNARAVKGLMDALNIGKAHLVGNSMGGATALN
FAIEYPERIGKLILMGPGGLGSSLFSAMPMEGIKLLFKLYAEPTLENLKQMLSVFVFDQT
QITDELIEGRWRAIQHNQVHLRNFLVSTQRVPLSAWDVTSRLGEIKAETLVIWGRDDRFV
PLDHGLKLAWHIHDARLHVLPRCGHWAQWEHAEEFNRLLIDFLQH
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaatcaatatacggaatctacaaccagcaggtttgccaagatcaacgagaagggattt
gaagacttccaggttcatttcaacgaagctggcgacggcgaggccgtcatcatgttgcac
ggtggtgggcccggggcaggtggatggagtaactatagccgcaatctgggcccgctggtt
caagccggttatcgcgtgattttgaaggactcgccaggatttaataaatccgaccccgtc
gtaatggacgaacagcgaggtctcgtgaacgcacgcgccgtcaagggtttgatggatgcc
ctaaacatcggaaaagcgcacctggtgggcaactcgatggggggggccaccgcactgaat
tttgccatcgaatatccggagcgcatcggtaagctcattctgatggggccgggggggctt
ggctcgagtctgttttccgcgatgcccatggaaggcatcaaattgcttttcaagctgtat
gccgagcctacgcttgaaaatttgaagcaaatgctatcggtatttgtttttgatcagacc
cagatcaccgatgaactgattgagggccgctggcgggctattcagcataatcaagtacac
cttcgaaattttcttgtcagtacgcaacgcgtgccattgagcgcttgggacgttacatcg
agattaggagagatcaaggcagaaacgcttgtcatctgggggcgcgacgaccgcttcgta
cctcttgaccatggattgaagttggcttggcacatccatgatgcgcgcttgcatgtcttg
cctcggtgcggtcactgggcgcaatgggaacatgctgaagagtttaatcgattgttgatc
gatttcttacaacattga

DBGET integrated database retrieval system