KEGG   Azoarcus sp. CIB: AzCIB_4453
Entry
AzCIB_4453        CDS       T04019                                 

Definition
(GenBank) hypothetical protein
Organism
azi  Azoarcus sp. CIB
SSDB
Motif
Pfam: DivIC
Other DBs
NCBI-ProteinID: AKU14342
UniProt: A0A0K1JCA3
LinkDB
Position
complement(4949752..4951152)
AA seq 466 aa
MKALISRFTQRAKPYTLAVALACAVTAAGVAWAQTRIDRSSVSVNGSVIGDDVLYSIGGG
RAVSMGGAGNMQSIGVGIGWNSNLICGNMSITTTLQNQLNGITNGFQAIMSTVIQNATSA
VASLPALIIQRADPGLYNLLTNGVLQARLDFDRSKMTCRAIANRLADMAGGQAGWDQLAE
GMALRDAVSSTDAVSAVEQAESNRGNNGVPWVGGGNAGGSGQSAIKVVGDMTRAGYNLLN
GRSATDTSSIPRTSCGNRLTCQTWSSPGAAAAWATRVLGEREQRTCDSCTKTQTTPGVGL
TPVIQEEYETKLQALQELVTGAKPTTVANLEAAGSNSLPITRGVIEALRDEPDQDLLGKR
LASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVKAVDQENSALEQEINNLKTELEL
RRTLAGNSAMAIVQRHGTRAGGSRGIFEGDTTRDRLKEVQKPRSTP
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaaagcactcatttcccgcttcactcagcgtgccaagccctacaccctggccgtcgcg
ctcgcctgtgccgtaacggcggccggtgtcgcctgggcgcagacccgcatcgaccgcagc
agcgtcagcgtgaatggcagcgtcatcggcgatgacgtgctctacagcatcggtggcggc
agggccgtgtccatgggcggtgctgggaacatgcagagcatcggcgtggggatcggctgg
aacagcaacctgatctgcggaaacatgagcatcacgaccacgctgcagaaccagctcaac
ggcatcaccaacggcttccaagcgatcatgagcaccgtgatccagaacgccaccagtgcg
gtggcgtcgctgccggcgctgatcatccagcgcgccgatccgggcctctacaacctgctc
accaacggcgtcctgcaggctcgcctggacttcgaccgctcgaagatgacctgccgggcc
atcgccaaccgcctggcggacatggcgggtgggcaggccgggtgggaccagctcgccgag
ggcatggcactgcgcgatgcggtgagcagcaccgatgccgtgtcggccgtcgagcaggcc
gagtcgaacaggggcaacaacggcgtgccctgggtcggcggcggcaacgcgggcggatcg
ggccagagtgcgatcaaggtggtgggcgacatgacgcgcgcgggctacaacctgctcaac
gggcgcagcgcgacggacacctcgtcgatcccgcgcacttcctgcggcaaccggctgacc
tgccagacctggtcctcgcctggtgcggctgcagcctgggcgacgcgcgtgctgggcgaa
cgtgagcagcgcacctgcgatagctgcaccaagacccagaccactcccggggtcgggctc
acgccggtgatccaggaggagtacgagaccaagctgcaggcgttgcaggaactggtgacc
ggtgcgaagccgacgacggtagcgaacctggaagcggccggcagcaattcgctgccgatc
acccgcggcgtgatcgaggccttgcgcgacgagcccgaccaggacctgctgggcaagcgc
ctggcgtcggaggcggcgctgtccagcgtgctggagaaggcactgctgttgcagcggacg
ctgctgaccggcaagaaagagccgaacgtcgcggccaacgagctggccgtgaaggcggtc
gaccaggagaacagcgcgctggagcaggagatcaacaacctcaagaccgagctggagctg
cggcgcacgctggcgggcaactccgcgatggccatcgtccagcgccacggcacccgcgcc
ggtggctcgcgcggcatcttcgagggcgacaccacgcgcgaccggctcaaggaagtccag
aagccccggagcacgccatga

DBGET integrated database retrieval system