KEGG   Azoarcus sp. CIB: AzCIB_4574Help
Entry
AzCIB_4574        CDS       T04019                                 

Definition
(GenBank) Superoxide dismutase (Cu-Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
azi  Azoarcus sp. CIB
Brite
Enzymes [BR:azi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AzCIB_4574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: AKU14460
UniProt: A0A0K1JCZ4
LinkDB All DBs
Position
complement(5068018..5068548)
Genome map
AA seq 176 aa AA seqDB search
MEFRSLIPTLPASLLIAACSNLGLGGPITAEASLAPTKGNSASGMVKFTEVDGGVVIDAS
VTGLSPGKHGFHIHEQGDCSAPDATSAGGHFNPTGKPHGDPAKGDHHLGDMPMLVADANG
DATFGTILEGLTISGKAKGNIVGRGLIVHAAPDDFTTQPTGNSGARVACGVIARLK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggaattccgctccctcatcccgacactgccagcaagcctcctcatcgccgcctgcagc
aacctcggccttggcgggccgatcaccgcggaagcgtccctcgcgccgaccaagggcaat
agcgcgtccggcatggtgaaattcaccgaagtcgatggcggtgtggtcatcgacgccagc
gtgacgggcctctcgcccggcaagcatggcttccacatccacgagcagggcgactgttcc
gcgcccgacgccaccagcgccggcggccatttcaacccgaccggcaagccgcacggcgac
ccggcgaaaggcgatcaccacctcggcgacatgccgatgctggtcgccgatgcgaacggc
gacgcgacgttcggcaccatcctcgaggggctgacgatcagcggcaaggccaagggcaac
atcgtcggccgcggcctcatcgtgcacgccgccccggacgatttcaccacccagccgacc
ggcaactccggcgcgcgcgtcgcgtgcggcgtgatcgcgcgcctgaagtag

DBGET integrated database retrieval system