KEGG   Azospirillum sp. B510: AZL_009040Help
Entry
AZL_009040        CDS       T01169                                 

Gene name
gutB
Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
azl  Azospirillum sp. B510
Pathway
azl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AZL_009040 (gutB)
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AZL_009040 (gutB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AZL_009040 (gutB)
    1.1.1.-  
     AZL_009040 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 DAO 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BAI71542
RhizoBase: AZL009040
UniProt: D3NT13
LinkDB All DBs
Position
complement(1026703..1027791)
Genome map
AA seq 362 aa AA seqDB search
MKAAVWHGRKDIRVEDVPLPGAPPAGWVQIKVHWCGICGSDLHEYVAGPVFIPVDTPHPL
TGLKGQCILGHEFSGEIATLGEGVTGFKVGDRVAADACQHCGECYYCKHGMYNICEKLAF
TGLMNNGAFASLVNVPAELLYKLPDGFPTEAGALIEPLAVGMHAVKKAASIVGETVVVVG
AGTIGLCTIMCAKAAGAGRIIVLEMSAARKAKALEVGATLVLDPKECDAVAEVKALTGGY
GADVSFECIGHRDTAKLAIDVIRKAGKTVLVGIFEEPSAFNFFEIVATEKQVIGSLAYNG
EFADVIRFIADGRIDVRPLITGRITLDDIVSGGFEELVAHKDRNVKIIVQPRAAAEQPEL
VH
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtctggcatggccgcaaggatatccgggtcgaggatgtgccgctgccg
ggcgccccgcccgccggctgggtccagatcaaggtgcattggtgcggcatctgcgggtcc
gacctgcatgaatatgtcgccggcccggtcttcatcccggtcgacaccccccacccgctg
accggcctgaaggggcaatgcatcctcggccacgagttcagcggcgagatcgcgacgctg
ggcgagggcgtcaccggcttcaaggtcggcgaccgagtggcggccgacgcctgccagcat
tgcggcgagtgctattactgcaagcacggcatgtacaacatctgcgagaagctggccttc
accggcctgatgaacaacggcgccttcgccagtctggtcaatgtcccggccgaactgctc
tacaagctgcccgacggcttcccgaccgaggccggcgccctgatcgaaccgctggcggtc
ggcatgcatgcggtgaagaaggccgcaagcatcgtcggcgagacggtggtggtggtcggc
gccggcaccatcgggctgtgcaccatcatgtgcgccaaggcggccggcgccggccggatc
atcgtcctggagatgtcggcggcccgcaaggccaaggcgctggaggtcggcgccacgctg
gtgctcgatcccaaggagtgcgacgcggtggcggaggtcaaggcgctgaccggcggttac
ggcgccgacgtgtcgttcgagtgcatcggccaccgcgacaccgccaagctcgccatcgac
gtcatccgcaaggccggcaagaccgtgctggtcggcatcttcgaggagccgagcgccttc
aacttcttcgagatcgtcgccaccgagaagcaggtcatcggctcgctggcctacaatggc
gagttcgccgacgtcatccgcttcatcgccgacggccgcatcgacgtgcggccgctgatc
accggccggatcacgctcgacgacatcgtcagcggcggcttcgaggagctggtcgcccac
aaggaccgcaatgtgaagatcatcgtgcagccgcgggcggcggccgaacagccggagctt
gtccactga

DBGET integrated database retrieval system