KEGG   Azospirillum sp. B510: AZL_015190Help
Entry
AZL_015190        CDS       T01169                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
azl  Azospirillum sp. B510
Pathway
azl00010  Glycolysis / Gluconeogenesis
azl00020  Citrate cycle (TCA cycle)
azl00620  Pyruvate metabolism
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
azl01130  Biosynthesis of antibiotics
azl01200  Carbon metabolism
Module
azl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZL_015190 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AZL_015190 (pdhC)
   00620 Pyruvate metabolism
    AZL_015190 (pdhC)
Enzymes [BR:azl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AZL_015190 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N RnfC_N
Motif
Other DBs
NCBI-ProteinID: BAI72157
RhizoBase: AZL015190
UniProt: D3NUS8
LinkDB All DBs
Position
complement(1752023..1753357)
Genome map
AA seq 444 aa AA seqDB search
MTVQILMPALSPTMTEGNLAKWLKKEGDTVKSGDVLAEIETDKATMEVEAVDEGRIGKIL
IPAGSQGVAVNTPIAILLEEGEDESALASAGSAPAPVPAAAPAPAQTAAPAAAPVPAPAP
AAPAAAPAAGGARVFASPLARRIAEQAGVDLKTVKGTGPHGRIVKADVEAAKAAGPAKVA
DTPAAAAPAAAPAPVAAPAPAPKAEGVDAKALADKLGMAYTAVPNSGMRKTIAKRLGEVK
RTVPDYYLTVDVEIDALMKVRAELNGRSDAYKLSVNDFIIRAVALALKKVPALNAAWTDE
AMLQFQHADVSVAVATPTGLITPIVKKAETKGLADISNEMKVLAKKARDNALKPEEYQGG
TISISNLGMMGIKQFAAIINPPQACILAVGASEQRPVVKDGALAIATVMSLTGTFDHRVA
DGAVGAEFLAAVKKLLEDPLSMLL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcagattctgatgcccgccctctcgcccacgatgaccgagggcaacctcgcc
aagtggctgaagaaggaaggcgacacggtgaagtccggcgacgtgctcgccgagatcgag
accgacaaggccaccatggaagtcgaggcggtcgatgaaggccgcatcggcaagatcctg
atcccggccggcagccagggcgtggcggtgaacacccccatcgccatcctgctggaagag
ggcgaggacgagagtgctttggcctccgccggctccgctcccgccccggttcccgccgcc
gccccggccccggcgcagacggcggctcccgccgccgctccggttccggctcccgctccg
gccgctccggccgccgctccggcggcaggtggcgcccgcgtgttcgccagcccgctggcc
cgccgcatcgccgaacaggccggcgtcgacctgaagacggtcaagggcaccggcccgcac
ggccgcatcgtcaaggccgacgtcgaggccgccaaggccgccggcccggccaaggtcgcc
gacaccccggccgcggccgctcccgccgccgccccggctccggttgccgccccggccccc
gctccgaaggccgagggcgtggatgccaaggcgctcgccgacaagctgggcatggcctac
accgccgtgccgaacagcggcatgcgcaagaccatcgccaagcgtctcggcgaggtgaag
cgcaccgttcccgactattacctgacggtggatgtcgagatcgacgcgttgatgaaggtc
cgcgccgagctgaacggccggtccgacgcctacaagctgtcggtgaacgacttcatcatc
cgcgccgtggcgctggcgctgaagaaggttccggcgctgaacgccgcctggaccgacgag
gcgatgctgcagttccagcatgccgacgtgtcggtcgcggtggcgactccgaccgggctg
atcaccccgatcgtcaagaaggcggagaccaagggtctggccgacatctccaacgagatg
aaggtgctggccaagaaggcgcgcgacaacgcgctgaagccggaagaatatcagggcggc
acgatctccatctccaacctgggcatgatggggatcaagcagttcgcggcgatcatcaac
ccgccgcaggcctgcatcctggcggtcggcgccagcgagcagcgcccggtcgtcaaggac
ggcgctctggccatcgccacggtgatgagcctgaccggcaccttcgatcaccgggtcgcc
gatggcgccgtcggtgcggaattccttgcggcggtgaagaagctgctcgaggatccgctc
tcgatgctgctctga

DBGET integrated database retrieval system