KEGG   Azospirillum sp. B510: AZL_020850Help
Entry
AZL_020850        CDS       T01169                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
azl  Azospirillum sp. B510
Pathway
azl00473  D-Alanine metabolism
azl00550  Peptidoglycan biosynthesis
azl01100  Metabolic pathways
azl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AZL_020850 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZL_020850 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AZL_020850 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:azl01011]
    AZL_020850 (ddlA)
Enzymes [BR:azl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AZL_020850 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:azl01011]
 Precursor biosynthesis
  Amino acid ligase
   AZL_020850 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 NAD_binding_8 GARS_A B12-binding ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAI72723
RhizoBase: AZL020850
UniProt: D3NWE4
LinkDB All DBs
Position
2390055..2391062
Genome map
AA seq 335 aa AA seqDB search
MGNQADRHRRRPRNRPMTEALLHAHKKHVAVLMGGWSAEREVSLVSGAGVAKALEEEGYR
VTAIDVQRDLGGLMQALTNPRPDVVFNALHGRGGEDGTIQGVLEFLGLPYTHSGVQAAAI
AMDKAMTKRLLDTVGIRSPKGMVLSRGEIAGGVHPMPAPYIVKPVDEGSTVGVTLVREGQ
NSPVGDDGSFGATFGERVLVEEFIPGRELTVGVMGDRALTVTEIVFQAQVYDYTAKYSAG
HAVHTLPAAIPEAVAEEAKRVAVLAHQTLGCRGVSRSDFRWDDSRPGTDGLYFLEINNQP
GMTPLSLVPEQAAHVGITYGALVGWLVENAACQLA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaagcggatcggcatcgccgccgcccaaggaaccgaccaatgaccgaagcc
ctgctccacgcccataagaagcatgtcgccgtcctgatgggcggctggtcagccgagcgc
gaggtatcgctggtcagcggggccggcgtcgccaaggcgctggaggaggaaggctaccgc
gtcaccgccatcgacgtgcagcgcgacctgggcgggctgatgcaggccctgaccaacccg
cggcccgacgtggtgttcaacgccctgcacggccgtggcggcgaggacgggacgatccag
ggcgtgctggagttcctcggcctgccctacacccattccggcgtccaggccgccgccatc
gccatggacaaggcgatgaccaagcggcttctcgacaccgtgggcatccgctcgcccaag
gggatggtgctgtcccgtggggagatcgccggcggcgtacaccccatgccggcgccctat
atcgtcaagccggtggacgagggctcgaccgttggcgtaaccctggtccgcgaggggcag
aacagcccggtcggcgacgacgggtcgttcggagcgaccttcggcgagcgcgtgctggtc
gaggagttcatccccggtcgcgaactgaccgtgggcgtcatgggtgaccgcgccttgacg
gtgaccgagatcgtcttccaggctcaggtctacgactacaccgcgaaatacagcgccggc
cacgccgtccacaccctccccgccgcgatccccgaggccgtggccgaggaggcgaagcgg
gtggcggtgctggcgcaccagaccctgggctgccggggtgtgtcgcgcagcgacttccgc
tgggatgacagccggccgggaaccgacgggctgtatttcctggagatcaacaaccagccg
ggcatgacgcccctgtcgctggtgcccgagcaggccgcgcatgtggggatcacctacggc
gcgctggtcggctggctggtggagaatgccgcatgtcagctcgcctga

DBGET integrated database retrieval system