KEGG   Azospirillum sp. B510: AZL_a00390Help
Entry
AZL_a00390        CDS       T01169                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
azl  Azospirillum sp. B510
Pathway
azl00500  Starch and sucrose metabolism
azl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZL_a00390
Enzymes [BR:azl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AZL_a00390
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AZL_a00390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: BAI73570
RhizoBase: AZLa00390
UniProt: D3NYU1
LinkDB All DBs
Position
pAB510a:47895..51242
Genome map
AA seq 1115 aa AA seqDB search
MIDRQDRLWYKDAVIYQLHIKAFFDADNDGIGDFAGLTQKLDYIQDLGVTAVWLLPFYPS
PLRDDGYDIADYTSVNPTYGTLEDFRRFMEECHNRGIRVITELVINHTSDQHPWFQRARE
APAGSNHRDYYVWSDSDQKYQGTRIIFCDTEKSNWTWDPVANAYYWHRFYSHQPDLNFDN
PEVLEEVLKVMRFWLDMGVDGLRLDAIPYLKEREGTNNENLPETHDVLKAIRAALDAEYP
DRMLLAEANQWPEDVLPYFGDPEKGGDECHMSFHFPLMPRIYMAVAMEDRHPIADIMRQT
PDIPADCQWAIFLRNHDELTLEMVTDSERDYLWNFYAADRRMRINLGIRRRLAPLLENDR
RKIELLNSLLLSMPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGGFSRADPAR
LYLPAVLDPIYGFMALNVEAQARNPSSLLNWMKRLVAVRKQRQSFGRGGFSLLYPGNRKV
LAYIRSLETEGGSEIALCVANLSRSAQAVELDLKAWKGRIPVELLGRTVFPPIGDLPYLL
TLPAYGFYWFALTAEAELPTWHETPPEPVPDLLTIVVRDGWHSLTTGRAADDLGRDILQA
FLPKQRWFSAKDRRITRSHVTLAAQLPGQGEGFMLVRTRVGLSGSWLDGDAADQSYFLPM
AMSWEEGAGGPGWPLLPYTLGKVRRGPRTGAIYDAVQADGFALALIEALRRGDTLKPTAG
EGAIRFSPTEALTAIELPPEAEVRRLGVEQSNTSVLVDSQIVVKVLRRLVEGEHPEVEMG
RFLTGVGFANTPALLGTVEQVAADGTPTALAVAQAFVRNQGDGWASTVEELERQLEDIRL
GVAGTTEDAAESGEPFGMHLVMMTTLGQRTAELHRALARSTGNAAFDPEPITPADLARWG
DAVRIQAEAAFAALPGALERLPAEVRTDAEQVLARRAEAMDRISALASMPPGGVKTRIHG
DYHLGQVVRAQNDWYILDFEGEPAKTLEERRAKSSPLRDVAGMLRSFNYAAWAALFRLDS
AGEGANSGDSPALAAARDWERRSIDSFLDGYRKAIEGCPAWPLGEDAARGLLTLFLLEKA
FYEIGYEAANRPNWIGIPVKGVLGLLDDAKEAGMV
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcggcaggaccggctctggtacaaggacgccgtcatctatcagctgcacatc
aaggcgttcttcgacgccgacaatgacggcatcggcgatttcgccggcctgacccagaag
ctggactatatccaggatctcggcgtcacggcggtgtggctgctgcccttctacccatcg
ccgctgcgtgacgacggctatgacatcgccgactacacctcggtcaacccgacctacggg
accctggaggatttccggcgcttcatggaggaatgccacaaccgcggcatccgggtgatc
accgagctggtcatcaaccacacctccgaccagcatccctggttccagcgcgcgcgggag
gcgccggccggctccaaccaccgcgactattatgtctggtccgacagcgaccagaaatac
cagggcacgcggatcatcttctgcgacaccgagaaatccaactggacctgggatccggtc
gccaacgcctattactggcaccgcttctattcgcaccagcccgacctgaacttcgacaat
cccgaagtgctggaggaggtgctgaaggtgatgcgcttctggctggacatgggggtggac
gggctgcggctcgacgccatcccctacctgaaggagcgcgagggcaccaacaacgagaat
ctgccggagacccacgacgtcctgaaggcgatccgcgcggcgctcgacgccgaatatccc
gaccgcatgctgctggccgaggccaaccagtggccggaggatgtgctgccctatttcggc
gatccggaaaagggcggcgacgaatgccacatgtccttccacttcccgctgatgccgcgc
atctacatggcggtggcgatggaggaccggcatcccatcgccgacatcatgcgccagacc
cccgacatcccggccgactgccagtgggcgatcttcctgcgcaaccatgacgagctgacg
ctggagatggtcaccgacagcgagcgcgactatctctggaacttctacgccgccgaccgg
cgcatgcggatcaacctcggcatccgccgccgcctcgccccgctgctggagaatgaccgc
cgcaagatcgagctgctgaacagcctgctgctgtcgatgcccggcacgccggtgctctat
tacggcgacgagatcggcatgggcgacaacatctatctcggcgaccgcgacggcgtgcgc
acgccgatgcaatggtcgatcgaccgcaacggcggcttctcgcgcgccgacccggcccgg
ctctatctgccggcggtgctcgacccgatctacggcttcatggcgctcaatgtcgaggcg
caggcccgcaacccctcctcgctgctgaactggatgaagcggctggtggcggtgcgcaag
cagcggcagagcttcggccgtggcggcttctcactgctctatcccggcaaccgcaaggtc
ctggcctacatccgctccctggaaacggaaggcgggtcggagatcgcgctgtgcgtcgcc
aatttgtcgcgttcggcccaggcggtggagctcgacctgaaggcctggaagggccgtatc
ccggtcgagctgctcggccgcaccgtcttcccgccgatcggcgaccttccctatctgctg
acgctgccggcctacggcttctactggttcgcgctcaccgccgaggcagaactgccgacc
tggcacgagactccgccggagccggtgccggatctgctgaccatcgtggtgcgtgacggc
tggcacagcctgaccaccggcagggcggcggacgatctcggccgtgacatcctccaggcc
ttcctgcccaagcagcgctggttctccgccaaggaccgccgcatcacccgctcgcacgtc
acgctcgccgcccagcttccgggacagggcgagggcttcatgctggtgcggacgcgggtg
gggctgagtgggagttggctggatggcgatgccgccgaccagagctatttcctgccgatg
gcgatgagctgggaggagggggccggcggccccggctggccgctgctgccctacacgctg
ggcaaggtgcggcgtggcccgcgcaccggcgccatctatgacgcggtgcaggccgacggc
ttcgccctggcgctgatcgaggcgctgcggcgcggcgacacgctgaaaccaaccgccggc
gagggggccatccgcttctccccgaccgaggcgctgaccgccatcgagttgccgcccgag
gccgaggttcggcgcctgggggtcgagcagagcaacacctccgtcctggtcgacagccag
atcgtggtgaaggtgctgcgccgtctggtcgagggcgagcatcccgaggtcgagatgggc
cgtttcctcaccggggtcggcttcgccaacaccccggccctgctgggcacggtggagcag
gtcgccgccgacggcacgccgaccgcgctggcggtggcccaggccttcgtccgcaaccag
ggcgacggctgggccagcacggtggaggagctggagcgccagctggaggacatccgcctg
ggcgtcgccggcaccaccgaggacgccgccgaatcgggggaacccttcggcatgcatctg
gtgatgatgaccacgctgggccaacgcaccgccgaactgcaccgggcgctggcgcggagc
accggcaacgcggccttcgatccggagccgatcacgcctgcggatctggcgcgctggggc
gacgccgtccgtatccaggccgaggccgccttcgccgccctgcccggggcgctggagcgt
ctgccggccgaggtgcggaccgacgccgaacaggtgttggcccgccgggccgaggcgatg
gaccgcatttcggcactggcgtcgatgccgcccggcggcgtcaagacccgcatccacggc
gactatcatctgggtcaggtcgtccgcgcccagaatgactggtatatcctcgatttcgag
ggtgagccggccaagacgctggaggaacgccgcgccaaatccagcccgttgcgcgacgtg
gccggcatgctgcgctccttcaactatgccgcctgggcggcgctgttccggctggacagc
gccggcgagggggccaacagcggcgacagcccggcgctggccgccgcccgcgactgggaa
cgccgcagcatcgactccttcctcgacggctaccgcaaggcgatcgagggctgcccggcc
tggcctttgggggaagacgccgcccgcggcctgctgaccctgttcctgctggagaaggcc
ttctacgagatcggctacgaggcggcgaaccggccgaactggatcggcatcccggtgaag
ggcgtgctggggttgctcgatgacgccaaggaggcgggcatggtgtga

DBGET integrated database retrieval system