KEGG   Azospirillum sp. B510: AZL_a04790Help
Entry
AZL_a04790        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
Organism
azl  Azospirillum sp. B510
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF442 Y_phosphatase3
Motif
Other DBs
NCBI-ProteinID: BAI74010
RhizoBase: AZLa04790
UniProt: D3P031
LinkDB All DBs
Position
pAB510a:complement(593641..594084)
Genome map
AA seq 147 aa AA seqDB search
MAIRQPAKVGKLLAGEQPSGDDLDVLKAQGVRSVVNLREDGERDRPSIPAEEGRQAEALG
LSFVHLPVTVPELSPELVEQFRRTVDALPGPVYVHCGLGQRAVTLALIVDAQDTGASAED
AIRDAERQGFEITPEVKTFIRTQLDRD
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccattcgccagcccgccaaggtcggcaagctgctcgccggagaacagccgagcggg
gatgatctggacgtgttgaaggcgcaaggtgtgcgcagcgtcgtcaacctgcgggaggac
ggcgagcgcgacaggccgtcgatcccggcggaggaaggccggcaagcggaggccctcggc
ttgtccttcgtccatcttccggtcaccgtcccggaactttctccggagctggtcgaacag
ttccgccggacggtcgatgccctgcccggcccggtctatgtccactgcggattgggacag
cgggcggtcacgctggcgctgatcgtggacgcccaggatacgggggccagcgccgaagac
gcgatccgtgacgcggagcgccagggcttcgaaatcacgcccgaggtcaagactttcatt
cggacgcagctcgaccgcgattga

DBGET integrated database retrieval system