KEGG   Azospirillum sp. B510: AZL_d00900Help
Entry
AZL_d00900        CDS       T01169                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZL_d00900 (ahpF)
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AZL_d00900 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin DAO AlaDh_PNT_C FAD_binding_3 K_oxygenase Thi4 FMO-like DUF3467 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAI75916
RhizoBase: AZLd00900
UniProt: D3P5I7
LinkDB All DBs
Position
pAB510d:105066..106661
Genome map
AA seq 531 aa AA seqDB search
MLDATLKTQLKAYLERITHPIALVASLDGGAKSQEMLGLLEDIAGLSDKIALDLNGHDAR
KPSFAINRVGTDYGVTFAGLPMGHEFNSLVLALLQVGGHPSKESEELLEQIRNLDGDFRF
ETYFSLTCQNCPDVVQALNLMSALNPRIKHVAIDGALFQQEVEQRQVMAVPTVFLNGEPF
AQGRMDVAQIVAKLDTGAVARAAEKIKAKAPFEVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLAAALEQHVKDYEVDVMNLQTATALVPASREGG
LIEVKLASGASLRSRTVVLSTGARWRSMNVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLIEFDSQLRADAVLQRKLHSLPNVTVLVSAQTTEVHGDG
GKVVGLSYKDRVGGEVKRLELEGIFVQIGLVPNTEWLKGTLALTPRGEIEVDNRGQTSLP
GVFAAGDATTVPFKQIIIAMGEGAKASLAAFDHLIRTVPAEEAAPATIAAE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccactctgaagacgcagttgaaggcctatctggagcgcatcacccacccc
atcgccctggtcgcctcgctggacggcggcgccaagtcgcaggagatgctgggtctgctg
gaggacatcgccgggctgtccgacaagatcgcgctggacctgaacggccatgacgcccgc
aagccctccttcgcgatcaaccgcgtcggcaccgattacggcgtgaccttcgccggcctg
ccgatggggcacgagttcaactcgctggttctggccctgctccaggtcggcggccacccg
tcgaaggaatccgaggagctgctggagcagatccgcaacctggacggcgatttccgcttc
gagacctatttctcgctgacctgccagaactgcccggacgtcgtccaggcgctgaacctg
atgagcgcgctgaacccgcggatcaagcatgtcgccatcgacggcgcgctgttccagcag
gaggtcgaacagcgtcaggtgatggcggttcccaccgtcttcctgaatggcgagcccttc
gcccagggccggatggacgtggcgcagatcgtcgccaagctcgacaccggcgccgtcgcc
cgcgccgccgagaagatcaaggccaaggcccccttcgaggtgctggtgatcggcggcggc
ccggccggcgccgccgccgccatctacgccgcccgcaagggcatccgcaccggcgtggcg
gcggagcgcttcggcggacaggtgctcgacaccatggcgatcgagaacttcatctcggtc
tcgcacaccgaggggccgaagctggcggcggcgctggaacagcacgtcaaggactatgag
gtcgacgtgatgaacctgcaaaccgccaccgcgctggtgccggcgtcgcgggaaggcggc
ctgatcgaggtgaagctggccagcggcgcctcgctgaggtcgcgcaccgtggtgctgtcg
accggtgcccgctggcgctcgatgaatgtcccgggcgaggcggaataccgcaacaagggg
gtcgcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggcgtcgaggcggcgatcgatctggccggcatcgtctcgcacgtc
acgctgatcgagttcgacagccagctgcgcgccgacgccgtgctccagcgcaagctgcac
agcctgccgaacgtcaccgtgctggtttcggcccagaccaccgaggtgcatggcgatggc
ggcaaggtcgtcggcctgtcctacaaggaccgcgtcggcggcgaggtgaagcggctggaa
ctggaaggcatcttcgtgcagatcggtctggtgccgaacaccgaatggctgaagggcacg
ctggcgctgaccccgcgcggcgagatcgaggtggacaaccgcggccagacctcgctgccc
ggcgtcttcgccgccggcgacgcgacgacggtgccgttcaagcagatcatcatcgccatg
ggcgagggcgccaaggcgtcgctggccgccttcgaccatctgatccgcaccgtcccggcc
gaggaggccgctcccgccaccatcgcggcggagtga

DBGET integrated database retrieval system