KEGG   Azospirillum sp. B510: AZL_e02270Help
Entry
AZL_e02270        CDS       T01169                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
azl  Azospirillum sp. B510
Pathway
azl00620  Pyruvate metabolism
azl00680  Methane metabolism
azl00710  Carbon fixation in photosynthetic organisms
azl01100  Metabolic pathways
azl01120  Microbial metabolism in diverse environments
azl01200  Carbon metabolism
Module
azl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:azl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZL_e02270 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZL_e02270 (ppc)
   00680 Methane metabolism
    AZL_e02270 (ppc)
Enzymes [BR:azl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AZL_e02270 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: BAI76572
RhizoBase: AZLe02270
UniProt: D3P7E3
LinkDB All DBs
Position
pAB510e:284504..287275
Genome map
AA seq 923 aa AA seqDB search
MSAILLQESSETKDQPLREDIRLLGRILGDTVRSQEGEAVFDIVERIRQTSIRFHRDEDE
GARKELEAILNSLSPPQTARVVRAYSFFSHLANIAEDQHHIRRTRAHALAGSAARDGTMT
HALDEATKAGVTTQQLKEFFDGALVSPVLTAHPTEVQRKSILTVQMAIAKLLAERDHGPM
TPEEEETNLESLQRAVLTLWQTAILRATKLAVTDEVSNGLTFYDYTFLREMPRFYAQLED
HLRKMDPSWTTTELPSFLRMGSWIGGDRDGNPFVTAPVLRQAMRMQSTRALQFYLDELHS
LGAELSLSTRVIDVSEPLRQLAERSPDPSPHRKLEPYRRAISGIYARLAATMRTLDGLEA
PLHAVGDAPPYLSPAEFGADLDIIDRSLTVNGSAALAKGRLRHLRRAVDLFGFHLASIDL
RQNSDVHERSVAELLSFADTGADYTALSEDERIALLVRELETNRPLASRYADYSEETSSE
LEILRTAADARARFGADAVVNCVISKTDGVSDILEVAVLLKEAGLLRPKDQTLDLNIAPL
FETIGDLRNCATTMDRLLSIPTYRRFLESRGNLQEVMLGYSDSNKDGGFMTSGWELYKAE
IALVEVFARHGVRLRLFHGRGGSVGRGGGPSYQAILAQPAGAVQGAIRITEQGEVIAGKY
SNPEVGRRNLETLAAATLEATLLHPESAAPCSDLFLQTMEELSEHAFKAYRGLVYETEGF
ERYFWESTVIGEIANLNIGSRPASRKKSTSIEDLRAIPWVFSWAQCRLMLPGWFGFGSAV
KAYLAEHPDGMERLRAMHRDWGFFSTLLSNMDMVLSKSNIAIASRYAGLVSDPALRDAIF
TRIRAEWQDSIDALLAITEQSALLEKNPLLARSIRNRFPYLDPLNHVQVELLKRHRTSDS
GEQIARGIHLTINGIAAGLRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcctgctgcaggaaagttccgagacgaaggaccagccgctccgtgaggac
atccgcctgttggggcggattctcggcgacaccgtccgcagtcaggagggggaggcggtg
ttcgacatcgtcgagcgcatccgccagacctccatccgcttccaccgtgacgaggacgag
ggcgcgcgcaaggagctggaggcgatcctgaacagcctgtcgccaccgcagacggcgcgg
gtggtgcgggcctacagcttcttctcgcacctcgccaacatcgccgaggaccagcaccac
atccgccgcacccgcgcccatgcgctcgccggatcggccgcgcgcgacggcaccatgacc
catgcgctggacgaggcgacgaaggccggcgtcaccacccagcagctgaaggagttcttc
gacggcgcgctggtcagcccggtgctgaccgcccatccgaccgaggtgcagcgcaagagc
atcctgaccgtgcagatggccatcgccaagctgttggccgagcgcgaccacggcccgatg
acgccggaggaggaggagaccaacctcgaatcgctccagcgcgccgtgctgaccctgtgg
cagaccgcgatcctgcgcgccaccaagctggcggtgacggacgaggtctcgaacggcctg
accttctatgactacaccttcctgcgcgagatgccgcgcttctatgcccagctggaggac
catctgcgcaagatggacccgtcctggacgacgacggagctgccgtccttcctgcgcatg
ggcagctggatcggcggcgaccgcgacggcaatcccttcgtcaccgcgccggtcctgcgt
caggcgatgcggatgcagagcacccgtgccctgcaattctatctggacgagctgcacagt
ctgggtgccgagctgtcgctgagcacccgcgtcatcgacgtgtcggaaccgttgcgccaa
ctggccgaacgctcgccagacccgtcgccgcaccgcaagctggagccctaccgccgcgcc
atttccggcatctatgcccggctggccgccaccatgcgcacgctggacgggctggaggcg
ccgctgcatgcggtcggcgacgcgccgccctatctgagcccggcggagttcggcgccgat
ctcgacatcatcgaccgttcgctgaccgtcaacggctcggccgcgctcgccaagggccgg
ctgcgtcacctgcgccgggcggtcgacctgttcggcttccatctcgccagcatcgatttg
cgccagaattccgacgtgcatgaacgttcggtggcggaactgctgtccttcgccgacacc
ggcgccgattacacggcgctgtcggaggatgagcggatcgcgctgctggtgcgcgagctg
gagaccaaccgcccgctggcctcgcgctatgccgactattcggaggaaaccagttccgag
ctggagatcctgcgtaccgccgccgacgcccgcgcccgcttcggcgccgatgcggtggtg
aactgcgtcatctccaagaccgacggcgtgtcggacatcctggaggtcgcggtcctgctg
aaggaggccgggctgctgcggccgaaggaccagacgctggacctgaacatcgccccgctg
ttcgagaccatcggcgacctgcgcaactgcgccaccaccatggaccggctgctgtcgatc
ccgacctaccggcgcttcctggaaagccgcggcaatctccaggaggtgatgctcggctat
tccgacagcaacaaggacggcggcttcatgacgtcgggctgggagctgtacaaggccgag
atcgcgctggtcgaggtgttcgccaggcatggcgtgcggctgcgtctgttccatggccgc
ggcggctcggtcggccgtggcggcggccccagctatcaggcgatcctggcccagccggcc
ggcgccgttcagggcgccatccgcatcaccgagcagggcgaggtcatcgccggcaaatat
tccaaccccgaggtcggccgccgcaacctggaaacgctggcggcggcgacgctggaagcc
acgctgctgcacccggaatcggcggccccctgtagcgacctgttcctccagaccatggag
gagctgtcggagcatgccttcaaggcctatcgcgggctggtctacgagaccgaggggttc
gagaggtatttctgggaatcgacggtgatcggcgagatcgccaacctcaacatcggcagc
cgcccggcctcgcgcaagaaatcgaccagcatcgaggatctgcgcgccattccctgggtg
ttcagctgggcgcaatgccgcctgatgctgcccggctggttcggtttcggctcggcggtg
aaggcctatctggccgaacatcccgacgggatggaacggctgcgcgccatgcaccgcgac
tggggcttcttcagcacgctgctgtccaacatggacatggtgctgtccaagtcgaacatc
gccatcgcctcgcgctatgccgggctggtgtcggatccggcgctgcgcgacgccatcttc
acccgcatccgggccgagtggcaggacagcatcgacgccctgctggcgatcaccgagcag
tcggccctcttggagaagaacccgctgctggcgcggtcgatccgcaaccgcttcccctat
ctcgacccgctcaaccatgtccaggtcgagttgctgaagcggcaccgcaccagcgacagc
ggcgagcagatcgcccgcggcatccatctgaccatcaacggcatcgccgccggcctgcgc
aacagcggctga

DBGET integrated database retrieval system