KEGG   Azospirillum sp. M2T2B2: DM194_04385Help
Entry
DM194_04385       CDS       T05500                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
azm  Azospirillum sp. M2T2B2
Brite
Enzymes [BR:azm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DM194_04385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AWU93560
UniProt: A0A2U9S205
LinkDB All DBs
Position
complement(963827..964420)
Genome map
AA seq 197 aa AA seqDB search
MAFELPPLPYAYDALAPYISSETLHLHHDKHHQTYVTNLNNLTKDTPLANASLEEVIKAS
AGDASKVGIFNNAAQVWNHTFFWQCLKKDGGKMPAALEQRIVADFGSVEKFKEELTQAAL
TQFGSGWAWLYLDGDKLKIGKTGNADTPLAHGHKPLFTIDVWEHAYYVDFQNRRADFVKA
VIDNLANWDFAAEQLAA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgaacttccgccgcttccgtatgcgtacgatgcgctggctccgtacatctcg
tcggagacgctgcacctgcaccacgacaagcaccaccagacctatgtcaccaacctgaac
aacctgaccaaggacaccccgctggccaatgccagcctggaggaggtcatcaaggcctcg
gccggtgacgcctccaaggtcggcatcttcaacaacgccgcccaggtgtggaaccacacc
ttcttctggcagtgcctgaagaaggacggcggcaagatgccggcggccctggagcagcgg
atcgtcgccgacttcggcagcgtcgagaagttcaaggaagagctgacccaggccgccctg
acccagttcggctccggctgggcctggctgtacctggacggcgacaagctgaagatcggc
aagaccggcaacgccgacaccccgctggcgcacggccacaagccgctgttcaccatcgac
gtgtgggagcatgcctactacgtcgacttccagaaccgccgcgccgacttcgtgaaggct
gtcatcgacaacctcgccaactgggacttcgccgccgagcagctggctgcgtaa

DBGET integrated database retrieval system