KEGG   Azospirillum sp. M2T2B2: DM194_07725Help
Entry
DM194_07725       CDS       T05500                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
azm  Azospirillum sp. M2T2B2
Pathway
azm00473  D-Alanine metabolism
azm00550  Peptidoglycan biosynthesis
azm01100  Metabolic pathways
azm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:azm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DM194_07725
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DM194_07725
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    DM194_07725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:azm01011]
    DM194_07725
Enzymes [BR:azm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DM194_07725
Peptidoglycan biosynthesis and degradation proteins [BR:azm01011]
 Precursor biosynthesis
  Amino acid ligase
   DM194_07725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AWU94163
UniProt: A0A2U9S5K0
LinkDB All DBs
Position
1671819..1672766
Genome map
AA seq 315 aa AA seqDB search
MTEALLHAHKKHVAVLMGGWSAEREVSLVSGAGVAKALEEEGYRVTAIDVQRDLGGLMNA
LTNPRPDVVFNALHGRGGEDGTIQGVLEFLGLPYTHSGVQAAAIAMDKAMTKRVLDTVGI
RSPKGMVLSRGEITGGTHPMPAPYIVKPVDEGSTVGVTLVREGQNSPVGDAWTFGERALV
EEFIPGRELTVGVMGDRALAVTEIVFQAQLYDYTAKYSAGHAVHTIPAAIPEAVAEEAKR
LAVLAHRTLGCRGVSRSDFRWDDGRPGTDGLYFLEINNQPGMTPLSLVPEQAAHVGISYG
ALVGWLVENAACQLA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccctgctccacgcccacaagaagcatgtcgccgtcctgatgggcggctgg
tcggccgagcgcgaggtgtcgctggtcagcggggccggcgtcgccaaggcgctggaggag
gaaggctaccgcgtcaccgccatcgacgtgcagcgcgatctgggcgggctgatgaacgcc
ctgaccaacccgcgccccgacgtggtgttcaacgccctgcacggtcgcggcggcgaggac
gggacgatccagggcgtgctggagttcctgggcctgccctacacccattccggcgtccag
gcggcggccatcgccatggacaaggcgatgaccaagcgggtgctcgacaccgtgggtatc
cgctcccccaaaggaatggtgctctcccgtggcgagatcaccggcggtacccaccccatg
ccggcgccctatatcgtcaagcctgtggacgaaggctcgaccgttggcgtaaccctggtc
cgcgaggggcagaacagcccggtcggcgacgcgtggaccttcggtgagcgtgcgctggtc
gaggagttcatcccaggtcgcgaactgaccgtgggcgtcatgggtgaccgcgctttggcg
gtgaccgagatcgtcttccaggctcagctctacgactataccgcgaaatacagcgccggc
cacgccgtccacaccatccccgccgcgatccccgaggccgtggcggaggaggcgaagcgg
ctggcggtgttggcgcaccgcaccctgggctgccggggtgtctcgcgcagcgacttccgc
tgggatgacggccggccgggaaccgacggtctgtacttcctggagatcaacaaccagccg
ggcatgacgcccctgtcgctggtgcccgaacaggcggcgcatgtgggaatctcctacggc
gcgctggtcggctggctcgtggagaatgccgcatgtcagctcgcctga

DBGET integrated database retrieval system