KEGG   Azospirillum sp. M2T2B2: DM194_13365Help
Entry
DM194_13365       CDS       T05500                                 

Definition
(GenBank) HlyD family secretion protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
azm  Azospirillum sp. M2T2B2
Brite
KEGG Orthology (KO) [BR:azm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azm02000]
    DM194_13365
Transporters [BR:azm02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   DM194_13365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 HlyD Biotin_lipoyl_2 FtsK_SpoIIIE Fez1
Motif
Other DBs
NCBI-ProteinID: AWU95329
UniProt: A0A2U9SCB3
LinkDB All DBs
Position
unnamed1:complement(145086..146195)
Genome map
AA seq 369 aa AA seqDB search
MAKGVRKIVLSGVALAVLAGGAVVGEQWWREGRFMESTDNAYVQSDITVVSPKVSAYVRD
VKAAENQLVRAGDVLAVLDDQDFRAKVAEADAAVTAQKAALGTLDSKLELQRTVIDQAAA
TLASAEAEQRRAQQEFERSRSLANDSWTSRQKLETADADLRKAVAQVAKSRAALAAENEQ
VNVLRATRTETEARLAQTEATLRTARIDLENTVVRAPVDGVVGNRGVQVGQYARPGVQLL
SLVPLPDVYVVANFKETQLSRMRPGQHVSISVDAFPDRNLVGTVESFAPASGSKFSLLPP
ENATGNFTKIVQRVPVRIALPRDNALAGLLRPGLSVVAEVDTRGADALPHVATGSVFGVL
GDKQAVAAK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaggcgttcggaagatcgtgctgtcgggcgtcgcgctggccgtgctggccggc
ggcgccgtcgtcggcgaacaatggtggcgggaaggccggttcatggaatcgaccgacaac
gcctatgtgcagagcgacatcaccgtggtcagcccgaaggtctccgcctatgtccgggac
gtgaaggcggccgaaaaccagctggtgcgggccggcgacgtgcttgcggtgctggacgac
caggacttccgcgccaaggtggctgaggcggatgcagcggtgaccgcgcagaaggcggcg
ctcggcacgctggactccaagctggagctgcagcgcacggtgatcgaccaggccgccgcc
acgctggcgagcgccgaggccgaacagcgccgcgcccagcaggagttcgagcgcagccgc
tcgctcgcgaacgacagctggacaagccggcagaagctggaaaccgccgacgccgacctg
cgcaaggcggtggcccaggtcgccaaatcgcgggcggcgctcgccgcggagaatgagcag
gtcaacgtcctgcgcgccacgcggacggaaacggaagcccgtctggcccagaccgaggcg
acgctgcggaccgcgcgcatcgacctggagaacaccgtggtgcgggcgccggtcgacggc
gtggtcggcaaccgcggcgtccaggtcggccagtatgcccggccgggcgtgcagctgctg
tcgctggttccgctgcccgacgtctatgtggttgccaatttcaaggagacccagctgtca
cgcatgcgccccggccagcatgtcagcatctcggtcgatgccttccccgaccgcaatctg
gtaggcacggtggagagcttcgcacccgcgtcgggttccaagttctcgctgctgccgccg
gagaacgcgaccggcaacttcaccaagatcgtccagcgcgtgcccgtgcgcatcgccctg
ccgcgcgacaacgcgctggccggcctgctgcgccccggcctgtcggtggtggcggaggtc
gacacccgtggcgccgacgccctgccgcatgtagcgaccggcagcgtgttcggcgtgctc
ggcgacaagcaggcggtggcggccaagtag

DBGET integrated database retrieval system