KEGG   Azospirillum sp. M2T2B2: DM194_16350Help
Entry
DM194_16350       CDS       T05500                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
Organism
azm  Azospirillum sp. M2T2B2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AWU95840
UniProt: A0A2U9S8H7
LinkDB All DBs
Position
unnamed1:861471..862544
Genome map
AA seq 357 aa AA seqDB search
MVMMKAAVFVEPGRIVLDDKPIPDVGPLDALIRITTTTICGTDIHILKGEYPVNRGLTIG
HEPVGIIEKLGSAVSGYREGQRVIAGAITPSGHSNACQCGCPSQDGPDTAHGLKLLGGWR
FGNTIDGAQAEYLLVPDAMNNLARVPDELTDEEVLMCPDIMSTGFSGAERGDIRIGDTVA
VFAQGPIGLCATAGAKLKGATSIIAVDAVPARMVMAKRMGADHVVNFREVDPVEEIMRLT
DGRGVDVAIEALGTQATFEAALRVLRPGGTLSSLGVYSSDLRLPLGPFAAGLGDHTIVTS
LCPGGKERMRRLLEVVASGRVDLKPLVTHRFTLDRIEEAYDLFGHQRDGVLKVAITP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgatgaaagcggcagtgttcgtcgaaccgggccgcatcgtgctggacgacaaa
ccgatccccgatgtcgggccgcttgacgcgctgatccgcatcaccacgacgacgatctgc
ggaaccgacatccacatcctgaagggggagtacccggtcaatcgcggcctgaccatcggg
catgagccggtcggcatcatcgagaagcttggctccgccgtcagcggctatcgcgagggg
cagcgggtgatcgccggggccatcacccccagcggccacagcaacgcctgccaatgcggc
tgcccctcccaggacggcccagacaccgcccatggtctgaagttgctgggcggctggcgc
ttcggcaacaccatcgacggcgcccaggccgaatatctgctggtgccggacgcgatgaac
aacctcgcccgcgtccccgacgaactgacggacgaagaggtgctgatgtgccccgacatc
atgtccaccggcttctccggggctgagcgcggcgacatccgcatcggcgacacggtggcg
gtcttcgcccaggggcccatcgggctgtgtgccaccgccggggccaagctgaagggcgcc
acctccatcatcgccgtcgacgccgtgccggcgcggatggtgatggcgaagcgaatgggc
gccgatcacgtggtcaacttccgcgaggtcgatccggtcgaggagatcatgcggctgacc
gacggccgcggcgtcgatgtcgccatcgaggcgctgggcacccaggcgaccttcgaggcg
gcgctgcgcgtcctgcggccgggcggaacgctgtccagcctgggcgtctattcaagcgac
ctgcgcctgccgctgggaccgttcgcggcggggctgggcgaccataccatcgtcacctcg
ctctgccccggcggcaaggagcggatgcgccggctgttggaggtcgtcgcctccggccgg
gtggacctgaagccgctggtcacccaccgcttcacgctggaccggatcgaggaggcctac
gacctgttcggccaccagcgcgacggcgtgctgaaggtggcgatcactccctag

DBGET integrated database retrieval system