KEGG   Azospirillum sp. M2T2B2: DM194_20525Help
Entry
DM194_20525       CDS       T05500                                 

Definition
(GenBank) hypothetical protein
Organism
azm  Azospirillum sp. M2T2B2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3040
Motif
Other DBs
NCBI-ProteinID: AWU96684
UniProt: A0A2U9SB24
LinkDB All DBs
Position
unnamed2:258072..259958
Genome map
AA seq 628 aa AA seqDB search
MGGALPPSVTSAAATAVAAPATPAPATAEATVVRLPERLPEVTRPVVLTGTVAGQTPEGL
TRVRTSAGELLLDSKTQLPPDKPVTIQITPGQTTPGTGTPSSTTLAPTTPGTIPAKPTAL
ILLQALGNPTGAAGGTAAATTPAGSPATGNAATPAVLLPTTPTPTTAPTLPPLLPGTVVP
ALVIAGGSGAKPMPAAPAGGAAPQPTAPSPAGSNPAGPAKPEAAAPATPSMPAPPTAGGS
ATFGTPVQLGGDAAHPGAGAPATPDRSAGTAGGTSAELPELPRGATVALKILTVTPPPQQ
PRPPGDPESGGRTGQGGGQTASQPGNQAGSQPSLDAEAPTLPPDTPVLRGTVAGSTPQGQ
PILATKQGMLALNVPASLPPGAKVTAALADLAQATQAAAPTLPGPPGPLDERDWPAMRQL
MATLAASDPALARSMLATMPQPNRKLTAALGFFLAAMRGGDARGWLGDDASSALDKAGRR
DLLERLDKDFEGLRREAAEALPGDWRSYTIPLMDSTGPKPIKLHVHPLKEDEEGDGRPRG
KPGSRFLIDLDLSRFGPMQLDGLVRPNHFDLILRSHAALPPELRVELIQVFADSVRAVGY
SGGLSFQSGARSWVKLTRAGQAGLGVSA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggcgctccctccatcggtcacctccgctgccgccaccgccgtggcggctccc
gccacgcccgcacccgctacggccgaggccacggtcgtccgcctgcccgagcggctgccg
gaggtgacccgcccggtggtgctgaccggcacagtcgccggccagacgccggaaggcctg
acccgcgtccgcacctcggcgggcgaactgctgctcgacagcaagacgcaactgccgccc
gacaagccggtcacaatccagatcacgcccggccaaaccacgcccggcaccggcacaccg
tcttccaccacgctagcccccacgacaccgggaacgatcccagccaagcccaccgcgttg
attttgctgcaggcgctgggcaatccgactggagcggcgggcggaacggccgcagccacg
acgccggcgggcagcccggcgaccggaaatgccgccactcccgccgtcctgctgccgacg
actcccacaccgacaacggcgcccaccctgccgccgctgctgcccggcacggtggtgccg
gcgctggtgatcgccggaggatcgggcgccaagccgatgccggcggcaccggccggcggc
gccgcaccccaaccgacagccccctccccggccggcagcaaccccgccggtccggccaag
cccgaggctgcggcacccgccacgccatccatgccggcgccgccgacggccggaggcagc
gcgaccttcggcactccggtccagctgggcggcgatgcggcgcaccccggcgccggagcg
ccggcaacgcccgaccggtctgccggcacggccggcggcacctccgccgagttgcccgag
ctgccgcgcggcgccacggtggcgttgaagatcctgaccgtaaccccgcctccgcaacag
ccgcgcccgcccggcgaccccgaatccggcggacggaccggacagggcggcggccagacc
gccagtcagcccggcaatcaggccggcagccaaccttctctggacgcggaagcccccacc
cttccgcccgacacccccgtcctgcgcggcacggtcgccggcagcacgccgcagggtcag
ccgatcctggcgaccaaacagggcatgctggccctcaacgtcccggccagcctgccgccg
ggggccaaggtcacggcggcgctcgccgatcttgcccaggcgacccaggcggcggccccc
accctgcccggcccgccggggccgctcgacgagcgtgactggccggcgatgcggcagctg
atggcgacactggcggcgtccgacccggcgctggccaggtcgatgctggcgaccatgcct
cagccgaaccgcaagctgaccgcggcgctgggcttcttcctggcggcgatgcgcggcggc
gatgcgcggggctggctcggcgacgatgcgtcgtccgcgctcgacaaggccgggcggcgc
gacctgctggagcggctggacaaggatttcgaggggctgcgccgcgaggccgcggaagcg
ctgccgggcgactggcgcagctacaccatcccgctgatggattccacgggcccgaagccg
atcaagctgcatgtccatcccctgaaggaggacgaggagggcgacggcaggccgcgcggc
aagcccggcagccgcttcctcatcgacctggacctcagccgcttcgggccgatgcagctg
gacggtctggtgcggccgaaccatttcgatctgatcctgcgcagccacgccgccctgccg
ccggaactgcgggtggaactgatccaggtcttcgccgacagcgtgcgggcggtgggctac
agcggcgggttgtccttccagtcgggcgcccgcagctgggtgaagctgacccgcgccggg
caggccgggcttggggtttcggcatga

DBGET integrated database retrieval system