KEGG   Azospirillum sp. M2T2B2: DM194_23375Help
Entry
DM194_23375       CDS       T05500                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
azm  Azospirillum sp. M2T2B2
Brite
KEGG Orthology (KO) [BR:azm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM194_23375
Enzymes [BR:azm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DM194_23375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 Glutaredoxin AlaDh_PNT_C FAD_binding_3 NAD_binding_7 K_oxygenase DAO Thi4 FMO-like NAD_binding_8 DUF3467
Motif
Other DBs
NCBI-ProteinID: AWU97234
UniProt: A0A2U9SCS6
LinkDB All DBs
Position
unnamed3:241349..242944
Genome map
AA seq 531 aa AA seqDB search
MLDANLKTQLKAYLERITHPITLVASLDGGAKSQEMLGLLEDIASLSDKITLDRSGADAR
KPSFAINRDGSDIGVTFAGLPMGHEFNSLVLALLQVGGHPSKESEELLEQIRNLDGDYRF
ETYFSLSCQNCPDVVQALNLMSALNPRIKHVAIDGALFQQEVEQRQVMAVPTVFLNGEPF
AQGRMDVAQIVAKLDTGAVARAAEKIKAKAPFEVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLAAALEQHVKDYEVDVMNLQTATALVPAAQEGG
LIEVKLANGASLKSRTVVLSTGARWRSMNVPGEAEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLHSLPNVTVIVSAQTTEVHGDG
NKVVGLSYKDRNSGELKRVDLEGIFVQIGLVPNTEWLKGTLALTPRGEIEVDNRGQTSLP
GVFAAGDATTVPFKQIVIAMGEGAKAALAAFDHLIRTVPAEEAVRETVAAE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctgaagacgcagttgaaggcttatctggagcgcatcacccatccg
atcacgctggtcgcgtcgctggacggcggtgcgaagtcgcaggaaatgctgggcctgctg
gaagacatcgcctcgctgtcggacaagatcaccctggaccgcagcggcgccgacgcccgc
aagccgtccttcgcgatcaaccgcgacggcagcgacatcggcgtcaccttcgccggcctg
ccgatggggcacgagttcaattcgctggtgctggccctgcttcaggtcggcggccacccg
tccaaggaatccgaggagttgctggagcagatccgcaacctggacggcgattaccgcttc
gagacctatttctcgctgtcctgccagaactgcccggacgtggtccaggccctgaacctg
atgagcgcgctgaacccgcggatcaagcatgtcgccatcgacggcgcgctgttccagcag
gaggtcgagcaacgccaggtgatggccgtgcccaccgtcttcctgaacggcgagcccttc
gcccagggccgcatggacgtggcgcagatcgtcgccaagctcgacaccggcgccgtcgcc
cgcgccgccgagaagatcaaggccaaggcccccttcgaggttctggtgatcggcggcggc
cccgccggcgccgcggccgccatctatgccgcccgcaagggcatccgcaccggcgtcgcg
gccgagcggttcggcggtcaggtgctcgacaccatggcgatcgagaacttcatctccgtc
tcccacaccgaggggccgaagctggccgcggcgctggaacagcacgtcaaggactatgag
gtcgacgtgatgaacctgcagaccgccaccgccctggtgccggcggcccaggaaggcggg
ctgatcgaggtgaagctggccaacggcgcctcgctgaagtcccgcaccgtggtgctgtcg
accggcgcccgctggcgctcgatgaacgtcccgggcgaggcggaataccgcaacaagggc
gtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtcgaggcggccatcgacctcgccggcatcgtggcccatgtc
acgctgatcgagttcgacagccagctgcgcgccgacgcggtgctgcagcgcaagctgcac
agcctgcccaacgtgaccgtcatcgtctcggcccagaccaccgaggtgcatggcgacggc
aacaaggtcgtcggcctgtcctacaaggaccgcaacagcggcgagctgaagcgggtggat
ctggagggcatcttcgtgcagatcggcttggtgcccaacaccgaatggctgaagggcacg
ctggcgctcaccccgcgcggcgagatcgaggtggacaaccgcggccagacctccctgccc
ggcgtgttcgccgccggcgacgcgacgacggtgccgttcaagcagatcgtcatcgccatg
ggcgagggtgcgaaggccgcactggccgccttcgaccacctgatccgcacggtgccggcc
gaggaagccgtacgggaaaccgtcgcggcggagtga

DBGET integrated database retrieval system