KEGG   Azoarcus sp. BH72: azo0170Help
Entry
azo0170           CDS       T00441                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA(GLN) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00970  Aminoacyl-tRNA biosynthesis
azo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    azo0170 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:azo03029]
    azo0170 (gatB)
Enzymes [BR:azo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     azo0170 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     azo0170 (gatB)
Mitochondrial biogenesis [BR:azo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    azo0170 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: CAL92788
RhizoBase: azo0170
UniProt: A1K1T3
LinkDB All DBs
Position
complement(186300..187760)
Genome map
AA seq 486 aa AA seqDB search
MSRSDWEVVIGLEVHAQLNTASKIFSGASTAFGAEPNVQASAVDIALPGVLPVLNRGAVE
RAIRFGLAIGATVAPTSVFARKNYFYPDLPKGYQISQFELPVVQGGTITIRVGEGENAYE
KTVNLTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARTLH
ALVRWIDICDGNMQEGSFRCDANVSVRKKGAEKFGTRREIKNLNSFRFLQQAIDYEVQWQ
IDTIEDGGTIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLVISPEWKARVQGE
MPELPEAMKARFIEQLGLSAYDATTLTASKEVATYYQATVDAAGAALAKPCANWVMGDLA
ARLNKAELDIAVSPVSPAQLAGLVARIADNTISNAIAKKVFEALWNGEGASADEIIDKQG
LKQVTDSGAIEAMIDEVLAANQKSVEEFRAGKDKAFNALVGQVMKASKGKASPAQVNELL
KKKLAG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagcagatcggattgggaagtcgtcatcgggctggaggtccatgcccagctcaacacc
gcgtcgaagattttctccggcgccagcaccgccttcggcgcggaacccaacgtccaggcg
agcgcggtcgatatcgcgctgccgggcgtgctgccggtgctcaaccgcggcgcggtcgaa
cgcgcgatccgcttcggcctcgcgatcggcgccacggtggcgccgaccagcgtgttcgcg
cgcaagaactacttctaccccgacctccccaagggttaccagatcagccagttcgagctg
ccggtggtgcagggcggcaccatcaccatccgcgtcggcgaaggtgagaacgcctacgag
aagacggtgaacctgacccgcgcccatctggaagaagacgccggcaagagcctgcacgaa
gatttccacggcatgagcggcatcgacctcaaccgcgccggcacgccgctgctcgagatc
gtctccgagcccgacatgcgctcgtcggcggaagccgtggcctacgcccgcacgctgcat
gcgctggtgcgctggatcgacatctgcgacggcaacatgcaggaaggctcgttccgctgc
gacgccaacgtctcggtgcgcaagaagggcgcggagaagttcggcacccggcgcgagatc
aagaacctcaactccttccgcttcctgcagcaggcgatcgactacgaggtgcagtggcag
atcgacaccatcgaggacggcggcaccatccagcaggccaccgtgctgttcgatccggac
accggcgagacgcgaatgatgcgctccaaggaagacgcccacgactaccgctacttcccc
gacccggacctgctgccgctggtgatttcgccggaatggaaggcgcgggtgcagggcgag
atgccggaactgccggaagcgatgaaggcccgcttcatcgagcagctcggcctctctgcc
tacgacgccaccacgctcaccgcgtccaaggaagtcgccacgtattaccaggccaccgtg
gacgccgccggcgccgcgctcgccaagccctgcgccaactgggtgatgggcgacctcgcc
gcgcgcctcaacaaggccgaactcgacatcgccgtgtcgccggtatcgcccgcccagctc
gccggcctggtggcgcgcatcgccgacaacaccatctccaacgcgatcgccaagaaggtg
ttcgaggcgttgtggaacggcgaaggcgccagtgctgacgaaatcatcgacaagcagggc
ctcaagcaggtcaccgacagcggcgcgatcgaagcgatgatcgacgaagtgctcgccgcc
aaccagaagtcggtggaggaattccgcgccggcaaggacaaggctttcaatgcgctggtg
ggccaggtcatgaaggcgagcaagggcaaggccagcccggcccaggtcaacgaactgctg
aagaagaagctggccggctga

DBGET integrated database retrieval system