KEGG   Azoarcus sp. BH72: azo0770Help
Entry
azo0770           CDS       T00441                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
azo  Azoarcus sp. BH72
Brite
KEGG Orthology (KO) [BR:azo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    azo0770 (ahpF)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     azo0770 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 Glutaredoxin K_oxygenase FMO-like Thi4 NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: CAL93387
RhizoBase: azo0770
UniProt: A1K3I2
LinkDB All DBs
Position
821802..823355
Genome map
AA seq 517 aa AA seqDB search
MLDANIKTQLKAYLERVTQPIEIVASLDDGAKSREMQELLADVAEQSHLITVIERRDDNE
RKPSFSVGPKGGEARVRFAGLPMGHEFTSLILALLQSAGYPPKVEADVIEQIKALEGEFN
FETYISLSCHNCPDVVQALNLLSILNPNIRHTMIDGGVFQEEVEKRQIMAVPTVYLNGQE
FGAGRMELGEILAKIDTGAAKRDAAKLSAKDVFDVLVVGGGPAGAAAAIYAARKGIRTGV
LAERFGGQVMDTLAIENFISVKETEGPKLAMALEEHVKQYEVDVMNLQRATALVPGDIHE
VRLENGGTLKAKTVILATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVAHVTLLEFADTLRADAVLQKKLASLPNVTVIKSAQTTEVTGAEKVN
GLVYKDRVSGEEKRLELEGIFVQIGLLPNTDFLKGTVELTRFGEIIVDAKGQTSVPGVFA
AGDCTTVPYKQIIIAMGEGSKASLAAFDHLIRTSVPA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaacatcaagactcaactgaaagcctatctggagcgggtgacgcagccg
atcgagatcgtggcgtcgctggacgatggcgcgaagtcgcgcgaaatgcaggaactgctg
gccgacgtcgccgagcagtcccacctgatcaccgtgatcgagcggcgcgatgacaatgag
cgcaagccctcgttctcggtcggccccaagggcggagaggcgcgcgtgcgctttgccggc
ctgccgatgggccacgaattcacctcgctcatcctcgcgctgctgcagtcggcgggttat
ccgccgaaggtcgaagccgacgtgatcgagcagatcaaggcgctcgaaggcgagttcaac
ttcgagacctacatctcgctgtcctgccacaactgcccggacgtggtgcaggccttgaac
ctgctgtccatcctcaaccccaacatccgccacaccatgatcgacggcggcgtgttccag
gaagaggtcgagaagcgccagatcatggcggtgcccaccgtctatctaaacggccaggag
tttggcgccggccgcatggaactcggtgaaatcctcgccaagatcgacaccggtgcggcc
aagcgcgacgcggccaagctctccgccaaggacgtgttcgacgtgctcgtcgtcggcggc
ggtccggcgggcgccgcggcggcgatctacgcggcgcgcaagggcatccgcaccggcgtg
ctggccgaacgcttcggcggccaggtgatggacacgctcgcgatcgagaacttcatctcg
gtgaaggaaaccgaaggtccgaagctcgcgatggcgctggaggagcacgtcaagcagtac
gaggtcgacgtgatgaacctgcagcgggcgaccgcactggtgccgggcgacatccacgag
gtcaggcttgaaaacggtggcacgctgaaggcgaagacggtgattctggcgaccggggcg
cgctggcgcgaaatgaacgtgccgggcgaaaaggaataccgcggcaagggcgtggcttac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggcggcggc
aactccggcgttgaagccgcgatcgatctcgccggcatcgtcgcccatgtcacgctgctg
gaatttgccgacaccctgcgtgcggacgcggtgctgcagaagaagctcgccagcctgccc
aacgtcacggtgatcaagagcgcacagaccaccgaggtgaccggggccgaaaaggtgaat
ggcctggtgtacaaggaccgcgtgagcggcgaagaaaagcgcctggagttggaaggcatc
ttcgtgcagatcggtctgctgcccaacaccgacttcctgaagggcacggtcgaactcacc
cgcttcggggagatcatcgtcgatgccaagggtcagacctcggtgccgggcgtattcgcc
gcgggcgactgcaccacggtgccgtacaagcagatcatcatcgcgatgggtgagggatca
aaggcctcgctggcggccttcgatcacctgatccggacgtcggtgcctgcctga

DBGET integrated database retrieval system