KEGG   Azoarcus sp. BH72: azo0992Help
Entry
azo0992           CDS       T00441                                 

Gene name
ppc
Definition
(GenBank) probable phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00620  Pyruvate metabolism
azo00680  Methane metabolism
azo00710  Carbon fixation in photosynthetic organisms
azo01100  Metabolic pathways
azo01120  Microbial metabolism in diverse environments
azo01200  Carbon metabolism
Module
azo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:azo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    azo0992 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    azo0992 (ppc)
   00680 Methane metabolism
    azo0992 (ppc)
Enzymes [BR:azo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     azo0992 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: CAL93609
RhizoBase: azo0992
UniProt: A1K454
LinkDB All DBs
Position
complement(1064654..1067407)
Genome map
AA seq 917 aa AA seqDB search
MTPDKDAPLREDIRLLGRLLGDTVRDQQGAASFDLIERIRQTSVRFRRDEDLAARRELED
TLDALSREQTIQVVRAFSYFSHLANIAEDQHHIRRSRAHLLAGSAPREGSLAHAVGHALD
EQRLDPTDLAAFFDTALISPVLTAHPTEVQRKSILNCQTVIARLLDERDRMQLTPDEAEA
NLDALRRAVLTLWQTRMLRPAKLSVIDEVNNGLSYFETTFLRELPRLYAALEDRLAGAQP
ALANHELPAFLQVGSWIGGDRDGNPYVTADVLEEALAMQARVALDYYLDELHTLGSQLSL
SQGLVGASDALLALADRSPDQSPHRSDEPYRRAIAGIYARLSATYRNLLGHPPARHAVAE
AEPYADVAALADDLDTLHRSLVANGTAALARGRLRHLRRAVRVFGFHLAPIDLRQNSDVH
ERVVAELLEVARPGAAYLAQDEAGRCALLLDELATARPLASPHVRYSDDSEGELAIFRAA
RRAHLRYGRGAIHNCIISKTDDLSDLLELAVLLKEAGLLRPLEKALDVNIVPLFETIGDL
ENAAGVMDRLFSIPVYRELLAARDQTQEVMLGYSDSNKDGGFLTSGWALYKAEGELVEVF
GRHGVRLRLFHGRGGSVGRGGGPSYQAILAQPDGAVQGQIRLTEQGEVIAAKYGNPEVGR
RNLEVLVAATLETSLRRDGGDATPRTFLDTMQALSDAAFTCYRGLVYETPGFEQYFWEST
VISEIAGLNIGSRPASRKKGTRIDDLRAIPWVFSWSQCRLMLPGWFGFGSAVKQWLAAHP
KDGLGLLQRMYREWSFFATLLSNMDMVLSKTDLAIASRYAELVKDPVLRDSIFERIRSEW
KDTVDALLAITEQVELLDANPLLKRSIRNRFPYLDPLNHVQVELLRRHREGNGEDARIRN
GIHISINGIAAGLRNSG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgactccagacaaggacgcacccctgcgcgaagacatccgcctgctcggccgcctgctc
ggcgataccgtgcgcgaccagcagggcgccgccagcttcgacctgatcgagcgcatccgc
cagacctcggtgcgctttcgccgcgacgaagacctcgccgcccggcgcgaactcgaggac
accctggacgcgctgtcgcgcgagcagacgatccaggtggtgcgcgcgttcagctacttc
tcgcacctcgccaacatcgccgaggaccagcaccacatccgccgctcgcgcgcgcacctg
ctggccggctccgccccgcgtgagggcagcctggcccatgccgtcgggcatgcgctcgac
gaacagcggctcgaccccaccgaccttgccgcgttcttcgacaccgcgctgatctcgccg
gtgctgaccgcgcaccccaccgaggtgcagcgcaagagcatcctcaactgccagaccgtg
atcgcccgtctgctcgacgagcgcgaccgcatgcagctcacgccggacgaagccgaagcc
aacctggatgcgctgcgccgggcggtgctgacgctgtggcagacgcgcatgctgcgtccg
gccaagctgtcggtgatcgacgaggtgaataacggcttgtcctacttcgagacgaccttc
ctgcgcgagctgccgaggctgtacgccgcactggaagaccgcctcgccggcgcccagccg
gcgctggccaaccacgagctgcccgccttcctgcaggtgggcagctggatcggcggcgac
cgcgacggcaacccctacgtcaccgccgacgtgctcgaagaggcgctggcgatgcaggcg
cgcgtcgcgctcgactactacctcgacgagctgcacacgctcggctcgcaactgtcgctt
tcacagggcctggtgggcgcctccgacgcgctgctggcgctggccgaccgctcgcccgac
caatcgccccaccgcagcgatgaaccctaccggcgcgcgatcgcgggcatctatgcacgc
ctctccgccacctaccgcaacctgctcggccatccgccggcacgccacgcggtggccgaa
gccgagccctacgctgatgtcgccgcgctcgccgacgacctcgatacgctccaccgctcg
ctggtcgccaacggcaccgcggcgctcgcacgcgggcgcctgcgccacctgcgccgcgcg
gtacgggtgttcggctttcacctcgcgccgatcgacctgcgccagaactccgacgtgcat
gagcgcgtcgtcgccgagctgctggaagtcgcgcgccccggcgccgcctatctcgcccag
gacgaggccggccgctgcgccctgctgctggacgaactggcgacggcgcggccgctcgcc
tcgccgcacgtgcgctacagcgacgacagcgagggcgagctggcgatcttccgcgccgcg
cgtcgcgcccacctgcgctacgggcgcggtgcgatccacaactgcatcatctccaagacc
gacgacctgtccgacctgctcgaactcgcggtgctgctgaaggaagcgggactgctgcgc
ccgctggagaaggcgctggatgtgaacatcgtgccgctgttcgagaccatcggcgacctc
gagaacgccgccggcgtcatggaccgcctgttctccatcccggtctatcgcgaactgctc
gccgcacgcgaccagacccaggaggtgatgctcggctattccgacagcaacaaggacggc
ggcttccttacctcgggctgggcgctgtacaaggcagagggtgaactggtcgaggtgttc
ggacgccacggcgtgcgcctgcgcctcttccacggccgcggcggctcggtgggccgcggc
ggcgggccgagctaccaggccatcctcgcccagccggacggcgcggtgcagggccagatc
cggctcacggaacagggcgaggtgatcgcggccaagtacggcaacccggaggtgggccgc
cgcaacctcgaagtactggtcgccgccacgctggaaaccagcctgcgccgcgatggcggc
gacgccacgccacgcaccttcctcgacacgatgcaggcgctgtcggacgccgccttcacc
tgttatcgcgggctggtgtacgaaacgccgggcttcgagcagtacttctgggagtcgacg
gtgatctccgagatcgccggcctcaacatcggttcgcgcccggcttcgcgaaagaaaggc
acccgtatcgacgacctgcgcgcgatcccgtgggtgttctcgtggtcgcagtgccggctg
atgctgccgggctggttcggcttcggcagcgcggtaaagcagtggctggcggcccatccc
aaggacggcctggggctgctgcagcggatgtaccgcgagtggtcgttcttcgcgacgctg
ctgtccaacatggacatggtgctgtccaagaccgacctcgcgatcgcctcacgctacgcg
gaactggtgaaggacccggtgctgcgggacagtatcttcgagcgcatccgcagcgaatgg
aaggacaccgtggatgcgttgctggcgatcaccgagcaggtggaactgctggacgccaac
ccgctgctcaagcgctcgatccgcaaccgctttccctacctggacccgctcaaccacgtc
caggtggagctgctgcggcgccaccgcgaaggcaacggcgaggatgcccgcatccgcaac
ggcatccacatctccatcaacggcatcgccgccggcctgcgcaacagcggctga

DBGET integrated database retrieval system