KEGG   Azoarcus sp. BH72: azo1146Help
Entry
azo1146           CDS       T00441                                 

Gene name
icd2
Definition
(GenBank) isocitrate dehydrogenase[NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00020  Citrate cycle (TCA cycle)
azo00480  Glutathione metabolism
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
azo01210  2-Oxocarboxylic acid metabolism
azo01230  Biosynthesis of amino acids
Module
azo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:azo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    azo1146 (icd2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    azo1146 (icd2)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     azo1146 (icd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: CAL93763
RhizoBase: azo1146
UniProt: A1K4K8
LinkDB All DBs
Position
1232133..1234370
Genome map
AA seq 745 aa AA seqDB search
MPSQQPTIIYTITDEAPMLATAAFLPVIRSFTKPAGIQIEEADISLAGRILAEFPDFLSD
AQKVPNTLAELGALTLKPEANIIKLPNISASVAQLKAAIKELQGKGYKIPDFPEDPKNDE
EKAIKTRYSKCLGSSVNPVLREGNSDRRAPAAVKNYAKKHPHSMGDWKQWSRTHVSHMEH
GDFYHGEKSMTLDKARDVKMELLTKSGKAIVLKPKVALLDGEVIDSMFMSKKALLEFYEQ
QLEDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMV
DLFDKIKTLPESKRDEIIRDLHACHEHRPELAMVDSAKGITNFHSPNDVIVDASMPAMIR
AGGKMYGADGKPYDCKAVMPESTFARIYQEMINFCKWHGNFDPRTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEDGVANITDLATGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHENELIKKVEKYLKDHDTSGLEIRIMSQVRAMRFTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMNGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEELGIKTGNAKAKVLAKTLDEATGKLLDLDKSPSRRTGELDNR
GSQFYLSLYWAQALAAQTDDAELAAQFGPLAKTLAENEQKIVDELKAVQGKPAEIGGYYR
VDVEKCTAVMRPSATFNAAIASIAG
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgcagcagccgaccatcatctacaccatcaccgacgaagcgccgatgctggcg
accgccgccttcctgccggtcatccgcagcttcaccaagccggcgggcatccagatcgaa
gaggcggatatctcgctcgctggccgcatcctggccgaatttcccgatttcctgagcgat
gcgcagaaggtgccgaacaccctggccgaactcggcgcgctgaccctgaagcccgaagcc
aacatcatcaagctgcccaacatcagcgcctcggtggcgcagctgaaggccgcgatcaag
gagctgcagggcaagggctacaagattcccgacttcccggaagacccgaagaacgacgaa
gagaaggcgatcaagacgcgctactccaagtgtctgggctcgtcggtgaacccggtgctg
cgcgaaggcaactccgaccgccgcgcgcccgccgcggtcaagaactacgccaagaagcac
ccgcactcgatgggcgactggaagcagtggtcgcgcacgcacgtgtcgcacatggagcat
ggcgacttctaccacggcgaaaagtcgatgacgctggacaaggcgcgcgacgtgaagatg
gagttgctgaccaagagcggcaaggccatcgtgctcaagcccaaggtcgcgctgctggac
ggcgaagtcatcgattcgatgttcatgagcaagaaggcgctgctcgagttctacgagcag
cagctcgaagactgccgcgaagcgggcatcctgttctcgctgcacgtgaaggcgacgatg
atgaaggtgtcgcaccccatcgtcttcggccactgcgtcaagatctactacaaggaagcc
ttcgagaagcacggcaagctgttcgacgagctgggcatcaacgtcaacaacggcatggtc
gacctgttcgacaagatcaagaccctgccggagtccaagcgcgacgagatcatccgtgac
ctgcacgcctgccacgagcatcgccccgaactggcgatggtggattcggccaagggcatc
accaacttccactcgcccaacgacgtcatcgtcgacgcctcgatgccggcgatgatccgc
gcgggcggcaagatgtacggcgccgacggcaagccctacgactgcaaggcggtgatgccg
gagtcgaccttcgcccgcatctaccaggagatgatcaacttctgcaaatggcacggcaac
ttcgacccgcgcacgatgggcacggtgccgaacgtcggcctgatggcgcagaaggccgaa
gagtacggctcgcacgacaagaccttcgagattccggaagacggcgtcgccaacatcacc
gacctggctaccggcgaagtgctgctgtcgcagaatgtggaagcgggcgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtgaagctcgccgtcacccgcgcg
cgcaactccggcatgccggcggtcttctggctcgacccctatcgtccgcacgaaaacgag
ctgatcaagaaggtcgagaagtatctgaaggatcacgacaccagcggcctcgagatccgg
atcatgagccaggtccgcgccatgcgtttcacgctggagcgcgtcgtccgcggcctcgac
accatctcggtcaccggcaacatcctgcgcgactacctcaccgacctgttcccgatcatg
gagctgggcacctcggccaagatgctgtccatcgttccgctgatgaacggcggcggcatg
tacgaaaccggcgccggcggttccgcgcccaagcacgtgcagcagctggtcgaggaaaac
cacctgcgctgggattcgctcggcgaattcctcgcgctggcggtgtcgctggaagaactc
ggcatcaagaccggcaacgccaaggccaaggtgctcgccaagacgctggacgaagccacc
ggcaagctgctggacctggacaagtcgccctcgcgtcgcaccggcgaactcgacaaccgc
ggcagccagttctatctgtcgctgtactgggcgcaggcgctggcggcgcagaccgacgac
gccgaactggccgcgcagttcggcccgctcgccaagacgctggccgagaacgagcagaag
atcgtcgacgagctgaaggcggtgcagggcaagcccgctgagatcggcggctactaccgc
gtcgacgtcgagaagtgcaccgcggtgatgcgtccgagtgccaccttcaacgccgcgatc
gccagcatcgccggctga

DBGET integrated database retrieval system