KEGG   Azoarcus sp. BH72: azo1727Help
Entry
azo1727           CDS       T00441                                 

Gene name
treS
Definition
(GenBank) putative trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00500  Starch and sucrose metabolism
azo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    azo1727 (treS)
Enzymes [BR:azo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     azo1727 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     azo1727 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: CAL94344
RhizoBase: azo1727
UniProt: A1K689
LinkDB All DBs
Position
1893796..1897116
Genome map
AA seq 1106 aa AA seqDB search
MPLNPPPGDDGLWYKDAVLYELHVKAFFDGNDDGIGDFAGLTRKLDYIHDLGVDTLWLLP
FYPSPLKDDGYDVADYHGVLPAYGTRNDFRVFVREAHRRGLRVITELVVNHTSDQHAWFQ
AARRAPPGSSKRNYYVWSDDPKRYAGTRIIFTDTETSNWAWDPVAQSYYWHRFFSHQPDL
NYENPNVLKAVLRTMRFWLDMGVDGFRLDAVPYLREREGTSNENLPETHATIREIRRVID
ENYRGRVLLAEANQWPEDVREYFGGNERGEGDECHMAYHFPLMPRLFMALAQEDRFPVVD
IMRQTPEIPDNCQWAIFLRNHDELTLEMVTDRERDYMWEFFANDPRMRLNVGIRRRLAPL
LENSRDRIELMSFLLLTMPGSPTLYYGDELGMGDNVYLGDRNGVRTPMQWTSDRNAGFSR
ADPQQLYLPPIMDPIYGYQTINVESQARNPHSLLNFNRRLIQMRKGYRAFGRGNLVFLEP
GNRKVLAYLREYVDPVAGEQRVLCVANLARTPQAVELDLARHEGRVPVEISGRTAFPPIG
RLPYLLTLPGHGFYAFELSAQAPAPQWHEERLPASDLPVLVLTEGWRTFVRSSDESNRVR
RAISSRSRAQLQDEVLLPYLRQRRWFAAKGDSIVRVEVVEEQEWVAEGASWLLVLLEVVI
ADAMPQTYFLPLAIAWEEGGEHPGDRFGAAALARVREKARMGLLYDAFVDPQFCRALARA
VGGGGAMAFGSGELRFVTTPAWQTLADAIQEDFRLPATEQTNTGVFFGQRLYLKGYRRLQ
AGINPELEMGYFLARAGFERIATVVGSAEFVTADGSASALAMMQAYVDSQGNAWDYTLDH
LGRLFSADTWPGADGERDTDGMNRVYLLQMATLGRRVGELHLALADDRGDPAFRPEPVDG
AEVENWRASVLRDIGHTLAQLAARAPALDAEAGALATRVLGMGEELAARVRDLDLDAHHL
FKTRYHGDLHLGQVLVVQNDFVIVDFEGEPARPMAQRRDKHLALRDVAGMLRSLDYAVRS
IELRIALAQPARDGALARALADWQRNATDAFVTAYHEVVPPPAAAADFLTLFVVEKLLYE
LRYELDNRPDWVRIPLAALAESGAAG
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgaaccccccgcccggtgacgacggcctctggtacaaggacgccgtcctctac
gaactgcacgtcaaggccttcttcgacggcaacgacgacggcatcggcgacttcgccggc
ctcacgcgcaagctcgactacatccacgacctcggcgtcgacacgctgtggctgctgccc
ttctacccctcgccgctgaaggacgacggctacgacgtggccgactaccacggcgtgctg
ccggcctacggcacccgcaacgacttccgcgtcttcgtgcgcgaggcccatcgccgcggg
ctgcgcgtgatcaccgagctggtggtgaaccacacctcggaccagcacgcctggttccag
gccgcacggcgcgcaccgccgggttcatcgaagcgcaactactacgtgtggagcgacgac
cccaagcgctacgccggcacccgcatcatcttcaccgacaccgaaacctccaactgggcg
tgggatccggtggcgcagtcctactactggcaccgcttcttcagccatcagccggacctc
aactacgagaaccccaacgtgctgaaggcggtgctgcgcacgatgcgcttctggctggac
atgggggtggatggcttccgcctcgacgcggtgccctacctgcgcgagcgcgaaggcacc
agcaacgagaacctgcccgaaacccacgccacgatccgcgagatccgccgcgtcatcgac
gagaactaccgcggccgcgtgctgctggccgaggccaaccagtggccggaggacgtgcgc
gaatacttcggcggcaacgagcgcggcgagggcgacgaatgccacatggcctaccacttc
ccgctgatgccgcggctgttcatggcgctggcgcaggaggaccgctttccggtggtggac
atcatgcggcagacgccggagatccccgacaactgccagtgggcgatcttcctgcgcaac
cacgacgagctgacgctggagatggtcaccgaccgcgagcgcgactacatgtgggagttc
ttcgccaacgacccgcgcatgcggctcaacgtcggcatccgccgccggctggcgccgctg
ctggaaaacagccgtgaccgcatcgagttgatgagcttcctgctgctcacgatgccgggc
tcgcccacgctgtactacggcgacgagctgggcatgggcgacaacgtctatctgggcgac
cgcaacggcgtgcgcacgccgatgcaatggacctccgaccgcaatgccggcttttcgcgc
gccgatccgcagcagctctacctgccgccgatcatggacccgatctacggctaccagact
atcaacgtcgaatcgcaggcgcgcaatccgcattcgctgctcaacttcaaccgccgcctg
atccagatgcgcaagggctaccgcgcgttcggccgcggcaacctggtgttcctggaaccg
ggcaaccgcaaggtgctggcctatctgcgcgaatacgtggacccggtggcgggcgagcag
cgcgtgctgtgcgtcgccaacctcgcgcgcacgccgcaggcggtggaactggacctcgcg
cgccacgagggcagggtgccggtggaaatctccggccgcaccgcgttcccgccgatcggc
cggctgccctatctgctgacgctgccgggccacggcttctacgccttcgagctttccgcg
caggcgcctgcgccgcagtggcatgaagaacggctgccggcctccgacctgccggtgctg
gtgctcaccgagggctggcgcaccttcgtgcgcagcagcgacgagagcaaccgcgtgcgc
cgcgccatctccagccgcagccgcgcgcaattgcaggatgaagtgctgctgccctacctg
cgccagcgccgctggttcgccgccaagggcgacagcatcgtgcgcgtcgaggtggtggag
gagcaggagtgggtcgccgagggcgccagctggctgctggtgttgctggaggtggtcatc
gcggacgcgatgccgcagacctatttcctcccgctggcgatcgcctgggaggagggcggc
gaacacccgggcgaccgcttcggcgccgctgcgctggcccgcgtgcgcgagaaggcgcgc
atgggcctgctctacgacgccttcgtcgacccgcagttctgccgtgcgctcgcccgcgcg
gtggggggcggcggcgcgatggccttcggcagcggcgaactgcgcttcgtcaccacgccg
gcctggcagacgctggccgatgccatccaggaggacttccgcctgccggccaccgagcag
accaacaccggcgtgttcttcggccagcggctgtacctgaagggctaccggcgcctgcaa
gcgggcatcaaccccgagctggagatgggctatttccttgcccgcgccggcttcgagcgg
atcgccaccgtagtcggttcggcggaattcgttaccgccgacggcagcgcctcggcgctg
gcgatgatgcaggcctatgtcgacagccagggcaatgcctgggactacacgctggaccac
ctcggccggctgttctcggccgacacctggcccggcgccgacggcgagcgcgacaccgac
ggcatgaaccgggtgtatctgctgcagatggcgacgctcgggcggcgcgtcggcgagctt
caccttgcgctggccgacgaccgcggcgatcccgccttccgccccgagccggtggatggg
gctgaagtggaaaactggcgcgccagcgtgctgcgcgacatcgggcatacgctggcgcaa
ctcgcggcgcgcgcgccggcgctggacgccgaggcaggcgcgctcgccacccgcgtgctg
gggatgggcgaggagcttgcggcgcgcgtgcgcgatctcgacctggatgcccaccacctg
ttcaagacgcgctaccacggcgacctccacctcggccaggtgctggtggtgcagaacgac
ttcgtgatcgtggatttcgagggcgaacccgcgcggcccatggcgcagcggcgcgacaag
cacctcgccctgcgcgatgtcgccggcatgctgcgttcactggattacgcggtgcgctcg
atcgagctgcgtatcgcgctggcgcagccggcgcgcgacggcgcgctcgcccgcgcgctg
gcggactggcagcgtaatgccaccgacgccttcgtcaccgcctatcacgaggtggtgcca
ccgcccgcggcggccgccgacttcctgacgctgttcgtggtcgagaagctgttgtacgag
ctgcgctacgaactggacaaccgccccgactgggtccgcattccgctcgccgcgctggcc
gaaagcggcgccgccggctag

DBGET integrated database retrieval system