KEGG   Azoarcus sp. BH72: azo2130Help
Entry
azo2130           CDS       T00441                                 

Gene name
fabI2
Definition
(GenBank) probable enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00061  Fatty acid biosynthesis
azo00780  Biotin metabolism
azo01100  Metabolic pathways
azo01130  Biosynthesis of antibiotics
azo01212  Fatty acid metabolism
Module
azo_M00083  Fatty acid biosynthesis, elongation
azo_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:azo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    azo2130 (fabI2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    azo2130 (fabI2)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    azo2130 (fabI2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:azo01004]
    azo2130 (fabI2)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     azo2130 (fabI2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     azo2130 (fabI2)
Lipid biosynthesis proteins [BR:azo01004]
 Fatty acid synthase
  Component type
   azo2130 (fabI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CAL94747
RhizoBase: azo2130
UniProt: A1K7E2
LinkDB All DBs
Position
2335612..2336391
Genome map
AA seq 259 aa AA seqDB search
MNPIINLEGKVGLITGIANEKSISTGVAEACAQAGAKLIITYQNEKTRAFIEPVINRLGV
EDVFLLDVTQPDTLDAAFAEIEARHGKLDFAVHSMAFAKRDDLHGRVVDTSPDGFALAMD
VSTHSFVRLARKAEPLMEKAGGGALVTMTYLGSEKVIPHYGVMGLCKAALEAATRYMAAE
LGAKNIRVNAVSPGPLMTRAASGIAGFDGLMAAAVDRSPLHSLVTPEDIGALTAFLVSDA
GRLISGGVHFVDAGYNVMG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgatcatcaaccttgaaggcaaagtcggcctcatcaccggcatcgccaacgaa
aagtcgatctccaccggcgtcgcagaggcctgcgcccaagccggcgccaagctcatcatc
acgtatcagaacgaaaagacgcgcgctttcatcgagccggtcatcaaccgcctgggcgta
gaggacgtctttctgctcgacgtgacccagcccgatacgctcgatgccgcgttcgcggag
atcgaagcgcgccacggcaagctcgatttcgccgtgcacagcatggcgtttgccaagcgc
gacgaccttcacggccgcgtcgtcgacacctcgcccgatggtttcgcgctggcgatggac
gtgtccacccactccttcgtacgtctggcgcgcaaggccgaaccgctgatggaaaaggcc
ggcggcggcgccctggtgacgatgacctatctgggctcggaaaaggtgattccgcactac
ggcgtgatggggctgtgcaaagcagcactcgaagccgccacacgctacatggcggcggaa
ctgggcgccaagaacatccgtgtgaacgcggtgtcgccgggccccctgatgacccgcgcg
gcgtccggcatcgccggtttcgacggcctgatggcggcggcggtggaccgctccccgctg
cacagcctggtgacgccggaagacatcggcgcgctcaccgccttcctcgtctccgacgcc
ggccgcctgatctccggcggggtgcacttcgtcgacgccggctacaacgtcatgggctga

DBGET integrated database retrieval system