KEGG   Azoarcus sp. BH72: azo2267Help
Entry
azo2267           CDS       T00441                                 

Gene name
gstB
Definition
(GenBank) putative glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:azo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    azo2267 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azo02000]
    azo2267 (gstB)
Enzymes [BR:azo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     azo2267 (gstB)
Transporters [BR:azo02000]
 Other Transporters
  Pores ion channels [TC:1]
   azo2267 (gstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: CAL94884
RhizoBase: azo2267
UniProt: A1K7S9
LinkDB All DBs
Position
complement(2483290..2483919)
Genome map
AA seq 209 aa AA seqDB search
MNELVLYTHPYSRGRIAHWMLEEVGQPHRIEWAEFGPAMKTPEFLALNPMGKVPVLTHGD
VVVTEAAAICAYLADRFPDSGLAPVAHDSARGPWYRWLFFAAGPVEQAVTAHSMGWQVPE
GKDAFVGFGSYARVLDTLEKAVSAAPYLCGEFSAADVYVGSHLGWGMMFGSIEKRPAFEE
YVARLQARPAAQRADRINAERIEAMQKKA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaactggttctatacacccatccctattcgcgcggacgcatcgctcactggatg
ctggaagaggtcgggcagccacaccgcatcgagtgggccgagttcggcccggcgatgaag
acgccggagttcctggcgctcaatcccatggggaaggtgccggtgctgacccacggtgat
gtggtcgtcaccgaggcggcggcgatctgcgcctacctcgccgaccgctttccggatagc
ggcctggcgccggtcgcgcatgactccgcgcgcggcccctggtaccgctggctgttcttc
gccgcggggccggtggagcaggcggtgaccgcgcattcgatgggctggcaagtgccggag
ggcaaggatgccttcgtcggcttcggcagctacgcgcgcgtgctcgacacgctggagaag
gccgtctcggcggcgccgtacctgtgcggcgagttcagcgcggccgatgtgtacgtcggt
tcccacctcggctgggggatgatgttcggcagcatcgagaagcgcccggcgttcgaggaa
tacgtcgccaggctgcaggcgcggccggcggcacagcgcgccgaccgcatcaacgccgag
cgcatcgaagccatgcagaagaaggcctga

DBGET integrated database retrieval system