KEGG   Azoarcus sp. BH72: azo3130Help
Entry
azo3130           CDS       T00441                                 

Gene name
dnaL
Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
azo  Azoarcus sp. BH72
Pathway
azo03030  DNA replication
azo03410  Base excision repair
azo03420  Nucleotide excision repair
azo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:azo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    azo3130 (dnaL)
   03410 Base excision repair
    azo3130 (dnaL)
   03420 Nucleotide excision repair
    azo3130 (dnaL)
   03430 Mismatch repair
    azo3130 (dnaL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:azo03032]
    azo3130 (dnaL)
   03400 DNA repair and recombination proteins [BR:azo03400]
    azo3130 (dnaL)
Enzymes [BR:azo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     azo3130 (dnaL)
    6.5.1.6  DNA ligase (ATP or NAD+)
     azo3130 (dnaL)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     azo3130 (dnaL)
DNA replication proteins [BR:azo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    azo3130 (dnaL)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     azo3130 (dnaL)
DNA repair and recombination proteins [BR:azo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     azo3130 (dnaL)
   NER (nucleotide excision repair)
    Other NER factors
     azo3130 (dnaL)
   MMR (mismatch exicision repair)
    Other MMR factors
     azo3130 (dnaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: CAL95747
RhizoBase: azo3130
UniProt: A1KA91
LinkDB All DBs
Position
complement(3437383..3438279)
Genome map
AA seq 298 aa AA seqDB search
MNSRPPFALSLLAAACVALALLSVLPANAIEPAAAERAPAVVPPALMLAGRYRDDIDPAA
YLVSEKLDGVRAYWDGTALRFRSGQPIEAPGWFVAALPRRPLDGELWLGRGRFEALSGLV
RRQQPDDAGWRAVRYMVFELPAAAGPFAAREAELRRIVAAAGVPWLQAVAQSRVRDRAEL
QARLAATVKAGGEGLMLHRADAAWRPGRVDTLLKLTPWLDDEARVVGYVAGKGRLAGVVG
ALEVEAADGRRFRLGSGLDDAQRRAPPPVGSLVTYRYRELTGKGLPRFPRFLRVRELP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgaactcacgcccgcctttcgcgcttagcctgctcgccgccgcctgtgtggcactcgcc
ctgctgtcggtcttgccggcaaatgcgatcgaacccgcggctgcggagcgcgcgccggct
gtcgttccgccggcgctgatgctggcggggcgctatcgcgacgacatcgatccggccgcc
tatctggtcagcgaaaagctggatggtgtgcgcgcctactgggacggcaccgcgctgcgc
tttcgcagcggacagccgatcgaggcgcccggctggtttgtcgccgcgttgccgcgccgt
ccgctcgacggcgaactgtggctggggcgcggacgtttcgaggcgctctccggcctcgtg
cggcgccagcagccggacgacgcgggctggcgggcggtgcgctacatggtgttcgagctg
ccggcagcggcggggccgtttgctgcccgcgaggccgagctgcgccgcatcgtcgccgct
gccggggtgccctggctgcaggccgtcgcacaatcccgcgtgcgggaccgggccgaactg
caggcacgtctggctgcaaccgtgaaggcgggcggtgagggtctgatgctgcaccgggcc
gatgcggcctggcgccccgggcgggtcgataccctgctcaagctgacgccctggctggac
gacgaggcgcgggtggtggggtatgtcgccggcaaggggcggcttgccggcgtcgtcggc
gcgctggaggtcgaggccgcagacggccgccgcttccgcctcggcagcgggctcgacgac
gcgcagcgccgcgcgcctccgcccgtcggcagcctcgtcacctatcgctaccgcgaactc
accggcaaggggctgccccgctttccgcgcttcctgcgggtgcgcgaactcccctag

DBGET integrated database retrieval system