KEGG   Azoarcus sp. M9-3-2: G3580_15200Help
Entry
G3580_15200       CDS       T06549                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
azq  Azoarcus sp. M9-3-2
Brite
KEGG Orthology (KO) [BR:azq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G3580_15200 (ahpF)
Enzymes [BR:azq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     G3580_15200 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 NAD_binding_8 Thi4 FMO-like K_oxygenase baeRF_family10
Motif
Other DBs
NCBI-ProteinID: QID18849
LinkDB All DBs
Position
complement(3271984..3273555)
Genome map
AA seq 523 aa AA seqDB search
MLDANLKQQLATYLQNLKLPIEITASVDGGEKSAEMLALLREIAELSTLISLTESRDDAE
RKPSFRINRVGADMGVRFAGIPMGHEFTSLVLALLQAGGHPPKVDEDTIAQIRALDGEFE
FVTYISLSCQNCPEVVQALNLMAVLNPKVRHTMVDGALFQAEVEEKKILAVPTVHLNGRE
FGQGRMNLKEILAKVDTGAQARAAAKLAEQDPFDVLIVGGGPAGAAAAIYAARKGVRTGV
LAERFGGQVMDTMAIENFISVQETEGPKLVAALEAHVKQYDVEVMDGFRAEALVPGEMNE
IQVAGGAHLKAKSVIIATGARWREMNVPGEREYRGKGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVAHVTLLEFGEQLRADAVLQAKLKSLPNVTIHTMAQTTEVTGADGKV
NGLTYTDRNNGESHHVELEGVFVQIGLLPNTDWLKGTVELSRFGEIEINPRCETSVAGVF
AAGDATTVPYKQIIIAMGEGSKAALSAFDHLIRASAPTEAVPA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcgaacctcaaacaacagcttgccacctacctgcagaacctgaagctgccg
atcgagatcacggccagcgtggacggcggcgaaaagtccgccgagatgctggcgctgctc
agggagatcgcggagctctcgaccctgatttcgctgaccgaatcgcgcgacgatgccgag
cgcaagccgtccttccgcatcaatcgcgtcggcgccgacatgggggtgcgcttcgccggc
atccccatggggcacgaattcacctcgctggtgctcgcgctgctgcaggccggcggtcat
ccgcccaaggtggacgaggacaccatcgcccagatccgggcgctggacggcgagttcgag
ttcgtcacctacatctcgctgtcgtgccagaattgcccggaggtggtgcaggcgctcaac
ctcatggcggtgctcaatcccaaggtgcgccacaccatggtggacggtgccctgttccag
gccgaggtggaggagaagaagatcctcgcggtgccgaccgtgcatctgaacggccgggaa
ttcggccagggccgcatgaacctcaaggagatcctcgccaaggtggataccggcgcccag
gccagggctgccgccaaactcgccgagcaggaccctttcgacgtgctcatcgtcggcggc
ggcccggccggcgccgcggcggccatctacgcggcgcgcaagggcgtgcgcaccggcgtg
cttgccgagcgcttcggcggtcaggtgatggacaccatggccatcgagaacttcatctcg
gtgcaggagaccgaagggcccaagctcgtcgccgcgctcgaggcgcacgtcaagcagtac
gacgtggaagtcatggacggcttccgtgccgaggccctggtgccgggtgagatgaacgag
atccaggtggccggcggtgcccacctcaaggccaaatcggtgatcatcgccaccggtgcg
cgctggcgcgagatgaacgtgcccggcgagcgcgagtaccgcggcaagggcgtggcctac
tgcccgcactgcgacggtccgctcttcaagggcaagcgtgtcgccgtgatcgggggcggc
aactccggcgtcgaggcggccatcgacctggccggcatcgtcgcccacgtgaccctgctc
gaattcggcgaacagctgcgcgccgacgcggtgctccaggccaagctcaagagcctgccc
aacgtcaccatccacaccatggcgcagaccacggaagtgaccggtgccgacggcaaggtg
aatggactgacctacaccgaccgcaacaacggcgaatcccaccatgtggaactggaaggc
gtgttcgtgcagatcggcctgctcccgaacaccgactggctcaagggcacggtcgagctg
tcccgcttcggcgagatcgagatcaatccgcgctgcgagaccagcgtggccggcgtgttc
gcggcgggcgacgccaccacggtgccctacaagcagatcatcatcgccatgggcgagggg
tccaaggccgcgttgtcggccttcgatcacctgatccgggcgtccgcgcccaccgaggcg
gtgcccgcctga

DBGET integrated database retrieval system