KEGG   Azoarcus sp. DD4: CJ010_03605Help
Entry
CJ010_03605       CDS       T06048                                 

Definition
(GenBank) nitrogen fixation protein NifZ
  KO
K02597  nitrogen fixation protein NifZ
Organism
azr  Azoarcus sp. DD4
Brite
KEGG Orthology (KO) [BR:azr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    CJ010_03605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NifZ DUF4926
Motif
Other DBs
NCBI-ProteinID: QDF95700
UniProt: A0A4Y6KN06
LinkDB All DBs
Position
complement(755266..755754)
Genome map
AA seq 162 aa AA seqDB search
MKPEFDYGDRVRVTRNVRDDGTYPGKDVGDLLVRRGSIGTVIEIGTFLQDQIIYTVHFLE
IDRIIGCRQEEVIGADDEWNPSRYESREKVVAGRSFAIDGEVVVPKGTIGEIIKVLRDMP
GGVHYHVSFPTKFLCIPESSLEPLPPGVEAPAAVTSGEEEES
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgaattcgattacggcgaccgggtccgcgtcacgcgcaacgtgcgcgacgac
ggcacctatcccggcaaggacgtcggcgacctgctggtacgccgcggcagcatcggcacg
gtgatcgagatcggcaccttcctgcaggaccagatcatctacaccgtgcacttcctggag
atcgaccgcatcatcggctgtcgccaggaagaggtgatcggcgccgacgacgagtggaac
ccgagccgctacgagtcgcgcgaaaaggttgtggccggccgcagcttcgcgatcgacggc
gaggtcgtggtgcccaagggcaccatcggcgagatcatcaaggtcctgcgcgacatgccg
ggcggcgtgcattaccacgtctccttcccgaccaagttcctctgtattccggaatcctcg
ctggagccgctgccgccgggtgtcgaggcgcccgcggccgtgaccagcggggaggaggaa
gaatcgtga

DBGET integrated database retrieval system