KEGG   Azoarcus sp. DD4: CJ010_04755Help
Entry
CJ010_04755       CDS       T06048                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
azr  Azoarcus sp. DD4
Brite
KEGG Orthology (KO) [BR:azr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CJ010_04755
Enzymes [BR:azr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CJ010_04755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 Glutaredoxin K_oxygenase Thi4 NAD_binding_8 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: QDF95900
UniProt: A0A4Y6KNN6
LinkDB All DBs
Position
998615..1000168
Genome map
AA seq 517 aa AA seqDB search
MLDANIKTQLKAYLERVTQPIEIVASLDDGEKSREMRELLSDVAEQSNLITVIERRDDNE
RKPSFSVGPKGGEARVRFAGLPMGHEFTSLILALLQTAGYPPKVEADVIEQIKALEGEFN
FETYISLSCHNCPDVVQALNLLSILNPNIRHTMIDGALFQDEVEARKIMAVPTVYLNGQE
FGAGRMELGEILGRIDTGAAKRDAAKLSAKDVFDVLVVGGGPAGAAAAIYAARKGIRTGV
LAERFGGQVMDTLAIENFISVKETEGPKLAMALEEHVKQYEVDVMNLQRASALVPGELHE
VKLENGASLKAKTVILATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVAHVTLLEFADTLRADAVLQKKLASLPNVTVIKSAQTTEVTGADKVN
GLVYKDRVSGEEKRIELEGIFVQIGLLPNTDFLKGTVELSKFGEIIVDAKGQTSVPGVFA
AGDCTTVPYKQIIIAMGEGSKASLAAFDHLIRTSVPA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatatcaagactcaactgaaagcctatctggaacgggtgacgcagccg
atcgagatcgtggcgtcgctggacgatggcgaaaaatcgcgtgaaatgcgcgaactgctc
agcgatgtcgccgagcagtccaacctcatcaccgtgatcgagcgccgcgacgacaatgag
cgcaagccctcgttctcggtcggccccaagggcggagaggcgcgcgtgcgtttcgccggc
ctgccgatgggccatgaattcacctcgctcatcctcgcgctgctgcagaccgccggctat
ccgcccaaggtcgaagccgacgtgatcgagcagatcaaggcgctcgaaggcgagttcaac
ttcgagacctacatttcgctgtcctgccataactgccccgacgtggtgcaggcgctcaac
ctgctgtccatcctcaatcccaacatccgccacaccatgatcgacggcgcgctgttccag
gacgaggtcgaggcgcgcaagatcatggcagtgcccacggtctatctgaacggtcaggag
ttcggcgccggccgcatggagctgggcgagatcctcggcaggatcgacactggcgcggcc
aagcgcgacgccgccaagctgtcggccaaggacgtgttcgacgtgctcgtcgtcggcggc
ggcccggccggcgcggcggcggcgatctatgcggcgcgcaagggcatccgcaccggcgtg
ctggccgagcgtttcggcggccaggtgatggacacgctggcgatcgagaacttcatctcg
gtcaaggagaccgaagggcccaagctggcgatggcgttggaagagcacgtcaagcagtac
gaagtcgacgtgatgaatctgcagcgagcgagcgcactggtgccgggcgagctgcacgag
gtgaagctggaaaacggcgcctcgctgaaggccaagacggtgatcctcgccaccggtgca
cgctggcgcgagatgaacgtgccgggcgagaaggagtaccgcggcaagggtgtggcctac
tgcccgcactgcgacggtccgctgttcaagggcaagcgcgtggcggtgatcggcggcggc
aactccggcgtcgaggccgcgatcgacctcgccggcatcgtcgcccatgtgacgctgctg
gagttcgccgataccttgcgtgcggacgcagtgctgcagaagaagctcgccagcctgccc
aacgtcacggtgatcaagagcgcgcagaccacggaagtgacaggtgccgataaggtgaac
ggcctggtctacaaggatcgcgtgagcggcgaggaaaagcgcatcgagctcgaaggcatc
ttcgtgcagatcggcctgctgcccaacaccgactttctcaagggcacggtcgagctcagc
aagttcggtgaaatcatcgtcgatgccaagggccagacctcggtgccgggtgtgttcgct
gccggtgactgcaccacggtgccgtacaagcagatcatcatcgccatgggcgagggttcc
aaggcttcgctggcggccttcgatcacctgatccgcacctcggtcccggcctga

DBGET integrated database retrieval system